1PD6: PDB entry 1PD6

The NMR structure of domain C2 of human cardiac Myosin Binding Protein C. Determined by solution NMR. Released 3 Aug 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 735
Mol. weight: 11.77 kDa
Released: 3 Aug 2004

Explore 1PD6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1PD6 contains 1 α-helix and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	217-218	2	1
β-strand	222-226	5	2
β-strand	231-236	6	1
α-helix	243-244	2
β-strand	245-248	4	3
β-strand	252-253	2	3
β-strand	261-265	5	1
β-strand	268-273	6	1
β-strand	282-283	2	2
β-strand	284-288	5	3
β-strand	291-293	3	3
β-strand	296-300	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-binding protein C, cardiac-type, Domain C2	A	protein	104	Homo sapiens	Q14896 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1PD6_1 Myosin-binding protein C, cardiac-type, Domain C2 (chains A)
MHHHHHHSSMDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSG
SKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKE

Primary citation

Dissecting the N-terminal myosin binding site of human cardiac myosin-binding protein C. Structure and myosin binding of domain C2. Ababou, A., Gautel, M., Pfuhl, M. J Biol Chem (2007) 282:9204-9215. DOI 10.1074/jbc.M610899200 · PubMed

Other PDB entries of the same protein (UniProt Q14896 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CX2 1.3 Å, Crystal structure of the C1 domain of cardiac isoform of myosin binding protein-C at 1.3A
2V6H 1.55 Å, Crystal structure of the C1 domain of cardiac myosin binding protein-C
7LRG 6.1 Å, Filamentous actin decorated with human cardiac myosin binding protein C C2 domain
8G4L 6.4 Å, Cryo-EM structure of the human cardiac myosin filament
7TIJ 8.0 Å, Cardiac F-actin decorated with regulatory M-domain of cardiac myosin binding protein C
7TIT 8.0 Å, Cardiac thin filament decorated with regulatory M-domain of cardiac myosin binding…
7TJ7 8.0 Å, Cardiac thin filament decorated with C1 Ig-domain and regulatory M-domain of cardiac…
6G2T 9.0 Å, human cardiac myosin binding protein C C1 Ig-domain bound to native cardiac thin filament
6CXI 11.0 Å, Cardiac thin filament decorated with C0C1 fragment of cardiac myosin binding protein C…
6CXJ 11.0 Å, Cardiac thin filament decorated with C0C1 fragment of cardiac myosin binding protein C…
1GXE Central domain of cardiac myosin binding protein C
2AVG NMR structure of cC1 domain from Human Cardiac Myosin Binding Protein C

Browse structure collections

About this viewer

MolViewer shows 1PD6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.