3CX2: Myosin-binding protein C, cardiac-type

Crystal structure of the C1 domain of cardiac isoform of myosin binding protein-C at 1.3A. Determined by X-ray diffraction at 1.3 Å resolution. Released 1 Jul 2008.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,044
Mol. weight: 12.05 kDa
Released: 1 Jul 2008

Explore 3CX2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CX2 contains 3 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	152-154	3
β-strand	159	1	1
β-strand	164-167	4	2
β-strand	172-179	8	1
β-strand	188-193	6	2
β-strand	197-198	2	2
α-helix	199-202	4
β-strand	204	1	1
β-strand	207-214	8	1
β-strand	219-226	8	1
α-helix	231-233	3
β-strand	235-242	8	2
β-strand	247-257	11	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-binding protein C, cardiac-type	A	protein	108	Homo sapiens	Q14896 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3CX2_1 Myosin-binding protein C, cardiac-type (chains A)
DDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLH
DSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHE

Primary citation

An investigation into the protonation states of the C1 domain of cardiac myosin-binding protein C. Fisher, S.J., Helliwell, J.R., Khurshid, S. et al. Acta Crystallogr D Biol Crystallogr (2008) 64:658-664. DOI 10.1107/S0907444908008792 · PubMed

Other PDB entries of the same protein (UniProt Q14896 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V6H 1.55 Å, Crystal structure of the C1 domain of cardiac myosin binding protein-C
7LRG 6.1 Å, Filamentous actin decorated with human cardiac myosin binding protein C C2 domain
8G4L 6.4 Å, Cryo-EM structure of the human cardiac myosin filament
7TIJ 8.0 Å, Cardiac F-actin decorated with regulatory M-domain of cardiac myosin binding protein C
7TIT 8.0 Å, Cardiac thin filament decorated with regulatory M-domain of cardiac myosin binding…
7TJ7 8.0 Å, Cardiac thin filament decorated with C1 Ig-domain and regulatory M-domain of cardiac…
6G2T 9.0 Å, human cardiac myosin binding protein C C1 Ig-domain bound to native cardiac thin filament
6CXI 11.0 Å, Cardiac thin filament decorated with C0C1 fragment of cardiac myosin binding protein C…
6CXJ 11.0 Å, Cardiac thin filament decorated with C0C1 fragment of cardiac myosin binding protein C…
1GXE Central domain of cardiac myosin binding protein C
1PD6 The NMR structure of domain C2 of human cardiac Myosin Binding Protein C
2AVG NMR structure of cC1 domain from Human Cardiac Myosin Binding Protein C

Browse structure collections

About this viewer

MolViewer shows 3CX2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.