2AVG: Myosin-binding protein C, cardiac-type

NMR structure of cC1 domain from Human Cardiac Myosin Binding Protein C. Determined by solution NMR. Released 5 Sept 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 861
Mol. weight: 13.49 kDa
Released: 5 Sept 2006

Explore 2AVG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AVG contains 0 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7-9	3	1
β-strand	14-17	4	2
β-strand	21-29	9	1
β-strand	38-42	5	2
β-strand	57-64	8	1
β-strand	69-77	9	1
β-strand	85-93	9	2
β-strand	96-107	12	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-binding protein C, cardiac-type	A	protein	120	Homo sapiens	Q14896 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2AVG_1 Myosin-binding protein C, cardiac-type (chains A)
MHHHHHHSSMDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLS
SKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGGYRCEVSTKDKFDCSNFNLTVHEAM

Primary citation

Myosin binding protein C positioned to play a key role in regulation of muscle contraction: structure and interactions of domain C1. Ababou, A., Rostkova, E., Mistry, S. et al. J Mol Biol (2008) 384:615-630. DOI 10.1016/j.jmb.2008.09.065 · PubMed

Other PDB entries of the same protein (UniProt Q14896 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CX2 1.3 Å, Crystal structure of the C1 domain of cardiac isoform of myosin binding protein-C at 1.3A
2V6H 1.55 Å, Crystal structure of the C1 domain of cardiac myosin binding protein-C
7LRG 6.1 Å, Filamentous actin decorated with human cardiac myosin binding protein C C2 domain
8G4L 6.4 Å, Cryo-EM structure of the human cardiac myosin filament
7TIJ 8.0 Å, Cardiac F-actin decorated with regulatory M-domain of cardiac myosin binding protein C
7TIT 8.0 Å, Cardiac thin filament decorated with regulatory M-domain of cardiac myosin binding…
7TJ7 8.0 Å, Cardiac thin filament decorated with C1 Ig-domain and regulatory M-domain of cardiac…
6G2T 9.0 Å, human cardiac myosin binding protein C C1 Ig-domain bound to native cardiac thin filament
6CXI 11.0 Å, Cardiac thin filament decorated with C0C1 fragment of cardiac myosin binding protein C…
6CXJ 11.0 Å, Cardiac thin filament decorated with C0C1 fragment of cardiac myosin binding protein C…
1GXE Central domain of cardiac myosin binding protein C
1PD6 The NMR structure of domain C2 of human cardiac Myosin Binding Protein C

Browse structure collections

About this viewer

MolViewer shows 2AVG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.