Two crystal structures of the B1 immunoglobulin-binding domain of streptococcal protein G and comparison with NMR. Determined by X-ray diffraction at 2.07 Å resolution. Released 30 Apr 1994.
Explore 1PGA in 3D Show helices and sheets RCSB PDB PDBe
1PGA contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 1 |
| β-strand | 13-19 | 7 | 1 |
| α-helix | 23-36 | 14 | |
| β-strand | 42-46 | 5 | 1 |
| β-strand | 51-55 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein G | A | protein | 56 | Streptococcus sp. GX7805 | P06654 (AlphaFold model) |
>1PGA_1 PROTEIN G (chains A) MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Two crystal structures of the B1 immunoglobulin-binding domain of streptococcal protein G and comparison with NMR. Gallagher, T., Alexander, P., Bryan, P. et al. Biochemistry (1994) 33:4721-4729. DOI 10.1021/bi00181a032 · PubMed
Other PDB entries of the same protein (UniProt P06654 (AlphaFold model), which also has an AlphaFold model), best resolution first:
1PGA is part of these collections:
MolViewer shows 1PGA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.