1QKM: Estrogen receptor beta

Human oestrogen receptor beta ligand-binding domain in complex with partial agonist genistein. Determined by X-ray diffraction at 1.8 Å resolution. Released 28 Jul 2000.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,991
Mol. weight: 29 kDa
Ligands: GEN
Released: 28 Jul 2000

Explore 1QKM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QKM contains 12 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	265-274	10
α-helix	293-315	23
α-helix	319-321	3
α-helix	324-347	24
β-strand	353-355	3	1
β-strand	361-363	3	1
α-helix	364-369	6
α-helix	373-389	17
α-helix	394-406	13
α-helix	411-413	3
α-helix	421-443	23
α-helix	448-477	30
α-helix	481-483	3
α-helix	487-497	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Estrogen receptor beta	A	protein	255	HOMO SAPIENS	Q92731 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QKM_1 ESTROGEN RECEPTOR BETA (chains A)
VRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAK
KIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGIL
EIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDADSSRKLAHLLNAVT
DALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVYDLLLEM
LNAHVLRGCKSSITG

Ligands and cofactors

ID	Name	Formula	Copies
GEN	Genistein	C15 H10 O5	1

Primary citation

Structure of the Ligand-Binding Domain of Oestrogen Receptor Beta in the Presence of a Partial Agonist and a Full Antagonist. Pike, A.C.W., Brzozowski, A.M., Hubbard, R.E. et al. EMBO J (1999) 18:4608. DOI 10.1093/EMBOJ/18.17.4608 · PubMed

Other PDB entries of the same protein (UniProt Q92731 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3OLL 1.5 Å, Crystal structure of phosphorylated estrogen receptor beta ligand binding domain
7XVY 1.54 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with S-DPN
7XWQ 1.89 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with…
7XWP 1.92 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with…
2YJD 1.93 Å, Stapled peptide bound to Estrogen Receptor Beta
3OMQ 1.97 Å, Fragment-Based Design of novel Estrogen Receptor Ligands
9ECF 2.0 Å, Crystal structure of the hERbeta LBD complexed with androstenediol and SRC 2-2 peptide…
1YYE 2.03 Å, Crystal structure of estrogen receptor beta complexed with way-202196
3OMP 2.05 Å, Fragment-Based Design of novel Estrogen Receptor Ligands
7XVZ 2.08 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with…
2NV7 2.1 Å, Crystal Structure of Estrogen Receptor Beta Complexed with WAY-555
4J24 2.1 Å, Estrogen Receptor in complex with proline-flanked LXXLL peptides

Browse structure collections

About this viewer

MolViewer shows 1QKM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.