1QZG: Pot1 (protection of telomere)- ssDNA complex

Crystal structure of Pot1 (protection of telomere)- ssDNA complex. Determined by X-ray diffraction at 1.9 Å resolution. Released 18 Nov 2003.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Schizosaccharomyces pombe
Chains: 4
Atoms: 3,184
Mol. weight: 46.26 kDa
Ligands: TMP
Released: 18 Nov 2003

Explore 1QZG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QZG contains 9 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	8-16	9
β-strand	19-22	4	1
β-strand	25-28	4	1
α-helix	30-33	4
β-strand	41-57	17	2
β-strand	65-72	8	2
β-strand	83-89	7	2
β-strand	104-115	12	2
β-strand	118-131	14	2
β-strand	151	1	2
α-helix	152-153	2
α-helix	156-173	18

Chain B: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	6-16	11
β-strand	19-22	4	3
β-strand	25-28	4	3
α-helix	30-33	4
β-strand	41-57	17	4
β-strand	65-72	8	4
β-strand	83-89	7	4
β-strand	104-115	12	4
β-strand	118-131	14	4
α-helix	144-145	2
β-strand	151	1	4
α-helix	152-153	2
α-helix	156-173	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
telomeric single-stranded DNA	C, D	DNA	5
Protection of telomeres protein 1	A, B	protein	187	Schizosaccharomyces pombe	O13988 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>1QZG_1 telomeric single-stranded DNA (chains C, D)
GGTTA

Sequence of entity 2 (A, B), FASTA

>1QZG_2 Protection of telomeres protein 1 (chains A, B)
GPGGEDVIDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTPSRQS
LHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQPLLLHQITLRSYRDR
TQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKTGDKEEQFALLLNKIWDEQTNKHKN
GELLSTS

Ligands and cofactors

ID	Name	Formula	Copies
TMP	Thymidine-5'-phosphate	C10 H15 N2 O8 P	2

Primary citation

DNA self-recognition in the structure of Pot1 bound to telomeric single-stranded DNA. Lei, M., Podell, E.R., Baumann, P. et al. Nature (2003) 426:198-203. DOI 10.1038/nature02092 · PubMed

Other PDB entries of the same protein (UniProt O13988 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5USB 1.61 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
4HIK 1.64 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTACGGT)
4HIM 1.75 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGATACGGT)
4HIO 1.75 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTAACGGT)
4HJ7 1.78 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTAGGGT)
4HID 1.82 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GCTTACGGT)
4HJ9 1.85 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (CGGTTACGGT)
5USN 1.9 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
5USO 2.0 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
4HJ5 2.04 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTTCGGT)
4HJ8 2.04 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTACGCT)
4HJA 2.1 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (ACGGTTACGGT)

Browse structure collections

About this viewer

MolViewer shows 1QZG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.