1QZH: Pot1 (protection of telomere)- ssDNA complex

Crystal structure of Pot1 (protection of telomere)- ssDNA complex. Determined by X-ray diffraction at 2.4 Å resolution. Released 25 Nov 2003.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Schizosaccharomyces pombe
Chains: 12
Atoms: 9,033
Mol. weight: 138.6 kDa
Released: 25 Nov 2003

Explore 1QZH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QZH contains 23 α-helices and 48 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	8-15	8
β-strand	19-22	4	1
β-strand	25-28	4	1
α-helix	30-33	4
β-strand	42-57	16	2
β-strand	65-72	8	2
β-strand	83-89	7	2
β-strand	104-114	11	2
β-strand	119-131	13	2
α-helix	144-147	4
β-strand	151	1	2
α-helix	152-153	2
α-helix	156-171	16

Chain B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	8-15	8
β-strand	19-22	4	3
β-strand	25-28	4	3
α-helix	30-33	4
β-strand	41-57	17	4
β-strand	65-72	8	4
β-strand	83-89	7	4
β-strand	104-114	11	4
β-strand	119-131	13	4
β-strand	151	1	4
α-helix	152-153	2
α-helix	156-171	16

Chains C and F: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	8-15	8
β-strand	19-22	4	5
β-strand	25-28	4	5
α-helix	30-33	4
β-strand	42-57	16	6
β-strand	65-72	8	6
β-strand	83-89	7	6
β-strand	104-114	11	6
β-strand	119-131	13	6
β-strand	151	1	6
α-helix	156-171	16

Chain D: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	8-15	8
β-strand	19-22	4	7
β-strand	25-28	4	7
α-helix	30-33	4
β-strand	42-57	16	8
β-strand	65-72	8	8
β-strand	83-89	7	8
β-strand	104-115	12	8
β-strand	118-131	14	8
α-helix	144-147	4
β-strand	151	1	8
α-helix	156-171	16

Chain E: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	8-15	8
β-strand	19-22	4	9
β-strand	25-28	4	9
α-helix	30-33	4
β-strand	42-57	16	10
β-strand	65-72	8	10
β-strand	83-89	7	10
β-strand	104-114	11	10
β-strand	119-131	13	10
β-strand	151	1	10
α-helix	152-153	2
α-helix	156-171	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
telomeric single-stranded DNA	G, H, I, J, K, L	DNA	6
Protection of telomeres protein 1	A, B, C, D, E, F	protein	187	Schizosaccharomyces pombe	O13988 (AlphaFold model)

Sequence of entity 1 (G, H, I, J, K, L), FASTA

>1QZH_1 telomeric single-stranded DNA (chains G, H, I, J, K, L)
GGTTAC

Sequence of entity 2 (A, B, C, D, E, F), FASTA

>1QZH_2 Protection of telomeres protein 1 (chains A, B, C, D, E, F)
GPGGEDVIDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTPSRQS
LHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQPLLLHQITLRSYRDR
TQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKTGDKEEQFALLLNKIWDEQTNKHKN
GELLSTS

Primary citation

DNA self-recognition in the structure of Pot1 bound to telomeric single-stranded DNA. Lei, M., Podell, E.R., Baumann, P. et al. Nature (2003) 426:198-203. DOI 10.1038/nature02092 · PubMed

Other PDB entries of the same protein (UniProt O13988 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5USB 1.61 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
4HIK 1.64 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTACGGT)
4HIM 1.75 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGATACGGT)
4HIO 1.75 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTAACGGT)
4HJ7 1.78 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTAGGGT)
4HID 1.82 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GCTTACGGT)
4HJ9 1.85 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (CGGTTACGGT)
1QZG 1.9 Å, Crystal structure of Pot1 (protection of telomere)- ssDNA complex
5USN 1.9 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
5USO 2.0 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
4HJ5 2.04 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTTCGGT)
4HJ8 2.04 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTACGCT)

Browse structure collections

About this viewer

MolViewer shows 1QZH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.