1RL3: CAMP-free R1a subunit of PKA

Crystal structure of cAMP-free R1a subunit of PKA. Determined by X-ray diffraction at 2.7 Å resolution. Released 6 Jul 2004.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Bos taurus
Chains: 2
Atoms: 4,008
Mol. weight: 65.95 kDa
Ligands: PCG
Released: 6 Jul 2004

Explore 1RL3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RL3 contains 26 α-helices and 39 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	120-132	13
α-helix	141-150	10
β-strand	152-156	5	1
β-strand	161-165	5	2
β-strand	171-177	7	1
β-strand	179	1	3
β-strand	180-184	5	2
β-strand	187-188	2	2
β-strand	193	1	3
β-strand	197-198	2	1
α-helix	200-205	6
β-strand	210-215	6	2
β-strand	219-225	7	1
α-helix	226-228	3
α-helix	229-234	6
α-helix	235-242	8
α-helix	245-249	5
α-helix	252-256	5
α-helix	259-268	10
β-strand	270-271	2	4
β-strand	289-295	7	4
β-strand	298-299	2	5
β-strand	300-302	3	6
β-strand	303	1	7
β-strand	310	1	7
β-strand	315-316	2	5
β-strand	321-322	2	4
α-helix	324-325	2
α-helix	326-330	5
β-strand	335-337	3	6
β-strand	344-349	6	4
α-helix	350-356	7
α-helix	363-373	11

Chain B: 13 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	521-532	12
α-helix	534-536	3
α-helix	543-550	8
β-strand	552-556	5	8
β-strand	561-563	3	9
β-strand	571-577	7	8
β-strand	580-583	4	9
β-strand	588	1	9
β-strand	597-598	2	8
α-helix	600-605	6
β-strand	612-615	4	9
β-strand	619-625	7	8
α-helix	626-628	3
α-helix	629-633	5
α-helix	634-649	16
α-helix	652-654	3
α-helix	659-668	10
β-strand	670-674	5	10
β-strand	679	1	11
β-strand	689-690	2	12
β-strand	691-692	2	13
β-strand	693-695	3	10
β-strand	698-702	5	11
β-strand	711-716	6	11
β-strand	721-722	2	13
α-helix	726-729	4
β-strand	736-738	3	11
β-strand	743-747	5	10
β-strand	748-749	2	12
α-helix	750-756	7
α-helix	758-760	3
α-helix	761-765	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase type I-alpha regulatory chain	A, B	protein	288	Bos taurus	P00514 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1RL3_1 cAMP-dependent protein kinase type I-alpha regulatory chain (chains A, B)
RRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAM
FPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAA
TVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEP
VQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNR
PRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV

Ligands and cofactors

ID	Name	Formula	Copies
PCG	Cyclic guanosine monophosphate	C10 H12 N5 O7 P	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

RIalpha subunit of PKA: a cAMP-free structure reveals a hydrophobic capping mechanism for docking cAMP into site B. Wu, J., Brown, S., Xuong, N.H. et al. Structure (2004) 12:1057-1065. DOI 10.1016/j.str.2004.03.022 · PubMed

Other PDB entries of the same protein (UniProt P00514 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PNA 1.5 Å, Crystal Structure of cAMP bound (91-244)RIa Subunit of cAMP-dependent Protein Kinase
3FHI 2.0 Å, Crystal structure of a complex between the catalytic and regulatory (RI{alpha}) subunits…
3IM3 2.0 Å, Crystal structure of PKA RI alpha dimerization/docking domain
5HVZ 2.0 Å, Crystal structure of smAKAP AKB domain bound RIa dimerization/docking (D/D) complex at…
2QCS 2.2 Å, A complex structure between the Catalytic and Regulatory subunit of Protein Kinase A…
3IM4 2.29 Å, Crystal structure of cAMP-dependent Protein Kinase A Regulatory Subunit I alpha in…
1NE6 2.3 Å, Crystal structure of Sp-cAMP binding R1a subunit of cAMP-dependent protein kinase
3PLQ 2.3 Å, Crystal structure of PKA type I regulatory subunit bound with Rp-8-Br-cAMPS
1NE4 2.4 Å, Crystal Structure of Rp-cAMP Binding R1a Subunit of cAMP-dependent Protein Kinase
4X6R 2.4 Å, An Isoform-specific Myristylation Switch Targets RIIb PKA Holoenzymes to Membranes
3IIA 2.7 Å, Crystal structure of apo (91-244) RIa subunit of cAMP-dependent protein kinase
1RGS 2.8 Å, Regulatory subunit of camp dependent protein kinase

Browse structure collections

About this viewer

MolViewer shows 1RL3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.