Crystal structure of the human caspase-1 C285A mutant after removal of malonate. Determined by X-ray diffraction at 2.1 Å resolution. Released 10 Aug 2004.
Explore 1SC4 in 3D Show helices and sheets RCSB PDB PDBe
1SC4 contains 11 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 133-137 | 5 | |
| α-helix | 138-147 | 10 | |
| β-strand | 152 | 1 | 1 |
| α-helix | 153-157 | 5 | |
| β-strand | 164-169 | 6 | 2 |
| α-helix | 182-195 | 14 | |
| β-strand | 199-204 | 6 | 2 |
| α-helix | 208-219 | 12 | |
| α-helix | 222-226 | 5 | |
| β-strand | 230-237 | 8 | 2 |
| β-strand | 238 | 1 | 3 |
| β-strand | 242-244 | 3 | 3 |
| β-strand | 255-257 | 3 | 3 |
| α-helix | 258-265 | 8 | |
| α-helix | 271-273 | 3 | |
| β-strand | 278-285 | 8 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 327-332 | 6 | 2 |
| α-helix | 348-360 | 13 | |
| α-helix | 366-376 | 11 | |
| α-helix | 387 | 1 | |
| β-strand | 388-390 | 3 | 2 |
| β-strand | 397 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-1 beta convertase | A | protein | 178 | Homo sapiens | P29466 (AlphaFold model) |
| Interleukin-1 beta convertase | B | protein | 88 | Homo sapiens | P29466 (AlphaFold model) |
>1SC4_1 Interleukin-1 beta convertase (chains A) NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRR TGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGI REGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQAARGDSPGVVWFKD
>1SC4_2 Interleukin-1 beta convertase (chains B) AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFS FEQPDGRAQMPTTERVTLTRCFYLFPGH
Crystal structures of a ligand-free and malonate-bound human caspase-1: implications for the mechanism of substrate binding. Romanowski, M.J., Scheer, J.M., O'Brien, T. et al. Structure (2004) 12:1361-1371. DOI 10.1016/j.str.2004.05.010 · PubMed
Other PDB entries of the same protein (UniProt P29466 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1SC4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.