1SE3: Staphylococcal enterotoxin B

Name: PDB 1SE3: Staphylococcal enterotoxin B complexed with GM3 trisaccharide
Published: 1997-06-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Staphylococcal enterotoxin B complexed with GM3 trisaccharide. Determined by X-ray diffraction at 2.3 Å resolution. Released 16 Jun 1997.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Staphylococcus aureus
Chains: 1
Atoms: 2,153
Mol. weight: 29.04 kDa
Released: 16 Jun 1997

Explore 1SE3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SE3 contains 8 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
β-strand	17	1	1
α-helix	22-25	4
α-helix	26-28	3
β-strand	33-38	6	2
β-strand	42	1	3
β-strand	48-51	4	3
β-strand	63-67	5	3
α-helix	71-77	7
β-strand	82-86	5	2
β-strand	89	1	3
β-strand	111-115	5	3
β-strand	118-120	3	2
β-strand	125-138	14	4
β-strand	141	1	4
β-strand	145-152	8	4
β-strand	154-156	3	5
α-helix	157-171	15
β-strand	182-190	9	4
β-strand	195-199	5	4
α-helix	202-203	2
β-strand	205	1	1
α-helix	210-214	5
α-helix	215-219	5
β-strand	222-224	3	5
β-strand	229-236	8	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Staphylococcal enterotoxin B	A	protein	239	Staphylococcus aureus	P01552 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1SE3_1 STAPHYLOCOCCAL ENTEROTOXIN B (chains A)
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGN
YDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTE
HNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNS
PYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK

Primary citation

Residues defining V beta specificity in staphylococcal enterotoxins. Swaminathan, S., Furey, W., Pletcher, J. et al. Nat Struct Biol (1995) 2:680-686. DOI 10.1038/nsb0895-680 · PubMed

Other PDB entries of the same protein (UniProt P01552 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SEB 1.48 Å, Staphylococcal enterotoxin B
8YBO 1.59 Å, Crystal structure of nanobody SEB-Nb11 bound to staphylococcal enterotoxin B (SEB)
4RGO 1.8 Å, Structure of Staphylococcal Enterotoxin B bound to the neutralizing antibody 14G8
1SE4 1.9 Å, Staphylococcal enterotoxin B complexed with lactose
3GP7 1.9 Å, Staphylococcal Enterotoxin B mutant N23YK97SK98S
1D5M 2.0 Å, X-ray crystal structure of HLA-DR4 complexed with peptide and seb
1D5Z 2.0 Å, X-ray crystal structure of HLA-DR4 complexed with peptidomimetic and seb
1GOZ 2.0 Å, Structural basis for the altered T-cell receptor binding specificty in a superantigenic…
8YBM 2.04 Å, Crystal structure of nanobody SEB-Nb6 bound to staphylococcal enterotoxin B (SEB)
8YKT 2.04 Å, Fab and SEB complex
8YBP 2.08 Å, Crystal structure of nanobody SEB-Nb20 bound to staphylococcal enterotoxin B (SEB)
8YBN 2.18 Å, Crystal structure of nanobody SEB-Nb8 bound to staphylococcal enterotoxin B (SEB)

Browse structure collections

About this viewer

MolViewer shows 1SE3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.