1SYQ: Human vinculin head domain VH1, residues 1-258

Human vinculin head domain VH1, residues 1-258, in complex with human talin's vinculin binding site 1, residues 607-636. Determined by X-ray diffraction at 2.42 Å resolution. Released 20 Jul 2004.

Method: X-ray diffraction
Resolution: 2.42 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,389
Mol. weight: 32.19 kDa
Released: 20 Jul 2004

Explore 1SYQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SYQ contains 10 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
α-helix	7-26	20
α-helix	36-39	4
α-helix	41-62	22
α-helix	68-97	30
α-helix	102-145	44
α-helix	146-150	5
α-helix	154-179	26
β-strand	182	1	1
α-helix	185-218	34
α-helix	223-250	28

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	608-625	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
vinculin isoform VCL	A	protein	264	Homo sapiens	P18206 (AlphaFold model)
Talin 1	B	protein	25		Q9Y490 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1SYQ_1 vinculin isoform VCL (chains A)
HHHHHHMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNL
VRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRG
ILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKM
IDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTV
EKMSAEINEIIRVLQLTSWDEDAW

Sequence of entity 2 (B), FASTA

>1SYQ_2 Talin 1 (chains B)
PLLQAAKGLAGAVSELLRSAQPASA

Primary citation

Structural basis for amplifying vinculin activation by talin. Izard, T., Vonrhein, C. J Biol Chem (2004) 279:27667-27678. DOI 10.1074/jbc.M403076200 · PubMed

Other PDB entries of the same protein (UniProt P18206 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LN2 1.0 Å, The second SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
4LNP 1.41 Å, The first SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
3RF3 1.61 Å, Shigella IpaA-VBS3 in complex with human vinculin
1YDI 1.8 Å, Human Vinculin Head Domain (VH1, 1-258) in Complex with Human Alpha-Actinin's…
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
3TJ5 1.99 Å, human vinculin head domain (Vh1, residues 1-258) in complex with the vinculin binding…
3MYI 2.2 Å, Human metavinculin tail domain
4DJ9 2.25 Å, Human vinculin head domain Vh1 (residues 1-258) in complex with the talin vinculin…
1RKE 2.35 Å, Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
5L0I 2.45 Å, Human metavinculin MVt R975W cardiomyopathy-associated mutant (residues 959-1134)
3VF0 2.54 Å, Raver1 in complex with metavinculin L954 deletion mutant
9QWO 2.54 Å, Vinculin tail bound to paxillin LD2

Browse structure collections

About this viewer

MolViewer shows 1SYQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.