5L0I: Vinculin

Human metavinculin MVt R975W cardiomyopathy-associated mutant (residues 959-1134). Determined by X-ray diffraction at 2.45 Å resolution. Released 31 Aug 2016.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,436
Mol. weight: 19.76 kDa
Released: 31 Aug 2016

Explore 5L0I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5L0I contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	964-977	14
β-strand	980	1	1
α-helix	986-1004	19
α-helix	1011-1039	29
α-helix	1043-1075	33
α-helix	1081-1114	34
β-strand	1128	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vinculin	A	protein	176	Homo sapiens	P18206 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5L0I_1 Vinculin (chains A)
NQPVNQPILAAAQSLHWEATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQC
AKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTN
ISDEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ

Primary citation

Differential lipid binding of vinculin isoforms promotes quasi-equivalent dimerization. Chinthalapudi, K., Rangarajan, E.S., Brown, D.T. et al. Proc Natl Acad Sci U S A (2016) 113:9539-9544. DOI 10.1073/pnas.1600702113 · PubMed

Other PDB entries of the same protein (UniProt P18206 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LN2 1.0 Å, The second SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
4LNP 1.41 Å, The first SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
3RF3 1.61 Å, Shigella IpaA-VBS3 in complex with human vinculin
1YDI 1.8 Å, Human Vinculin Head Domain (VH1, 1-258) in Complex with Human Alpha-Actinin's…
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
3TJ5 1.99 Å, human vinculin head domain (Vh1, residues 1-258) in complex with the vinculin binding…
3MYI 2.2 Å, Human metavinculin tail domain
4DJ9 2.25 Å, Human vinculin head domain Vh1 (residues 1-258) in complex with the talin vinculin…
1RKE 2.35 Å, Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
1SYQ 2.42 Å, Human vinculin head domain VH1, residues 1-258, in complex with human talin's vinculin…
3VF0 2.54 Å, Raver1 in complex with metavinculin L954 deletion mutant
9QWO 2.54 Å, Vinculin tail bound to paxillin LD2

Browse structure collections

About this viewer

MolViewer shows 5L0I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.