3S90: Human vinculin head domain Vh1

Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33; residues 1512-1546). Determined by X-ray diffraction at 1.97 Å resolution. Released 22 Jun 2011.

Method: X-ray diffraction
Resolution: 1.97 Å
Organisms: Homo sapiens, Mus musculus
Chains: 4
Atoms: 4,694
Mol. weight: 64.74 kDa
Released: 22 Jun 2011

Explore 3S90 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3S90 contains 20 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
α-helix	7-28	22
α-helix	41-64	24
α-helix	68-97	30
α-helix	102-145	44
α-helix	148-150	3
α-helix	154-162	9
α-helix	165-179	15
β-strand	182	1	1
α-helix	185-218	34
α-helix	223-249	27

Chain B: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	2
α-helix	7-28	22
α-helix	36-39	4
α-helix	41-64	24
α-helix	68-97	30
α-helix	102-145	44
α-helix	148-150	3
α-helix	154-179	26
β-strand	182	1	2
α-helix	185-214	30
α-helix	223-250	28

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1521-1544	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vinculin	A, B	protein	253	Homo sapiens	P18206 (AlphaFold model)
Talin-1	C, D	protein	40	Mus musculus	P26039 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3S90_1 Vinculin (chains A, B)
MMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGK
ETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGT
SDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQ
QELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSA
EINEIIRVLQLTS

Sequence of entity 2 (C, D), FASTA

>3S90_2 Talin-1 (chains C, D)
GPLGSASARTANPTAKRQFVQSAKEVANSTANLVKTIKAL

Primary citation

Intermolecular versus intramolecular interactions of the vinculin binding site 33 of talin. Yogesha, S.D., Sharff, A., Bricogne, G. et al. Protein Sci (2011) 20:1471-1476. DOI 10.1002/pro.671 · PubMed

Other PDB entries of the same protein (UniProt P18206 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LN2 1.0 Å, The second SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
4LNP 1.41 Å, The first SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
3RF3 1.61 Å, Shigella IpaA-VBS3 in complex with human vinculin
1YDI 1.8 Å, Human Vinculin Head Domain (VH1, 1-258) in Complex with Human Alpha-Actinin's…
3TJ5 1.99 Å, human vinculin head domain (Vh1, residues 1-258) in complex with the vinculin binding…
3MYI 2.2 Å, Human metavinculin tail domain
4DJ9 2.25 Å, Human vinculin head domain Vh1 (residues 1-258) in complex with the talin vinculin…
1RKE 2.35 Å, Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
1SYQ 2.42 Å, Human vinculin head domain VH1, residues 1-258, in complex with human talin's vinculin…
5L0I 2.45 Å, Human metavinculin MVt R975W cardiomyopathy-associated mutant (residues 959-1134)
3VF0 2.54 Å, Raver1 in complex with metavinculin L954 deletion mutant
9QWO 2.54 Å, Vinculin tail bound to paxillin LD2

Browse structure collections

About this viewer

MolViewer shows 3S90 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.