5ZOJ: Human SMAD2-MAN1 complex

Crystal structure of human SMAD2-MAN1 complex. Determined by X-ray diffraction at 2.79 Å resolution. Released 10 Oct 2018.

Method: X-ray diffraction
Resolution: 2.79 Å
Organism: Homo sapiens
Chains: 5
Atoms: 6,383
Mol. weight: 97.5 kDa
Released: 10 Oct 2018

Explore 5ZOJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ZOJ contains 35 α-helices and 50 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	275-281	7	1
β-strand	284-285	2	1
α-helix	288-289	2
β-strand	290-291	2	1
β-strand	296-300	5	2
β-strand	310-312	3	2
α-helix	323-330	8
β-strand	336-341	6	2
β-strand	344-349	6	2
β-strand	355-358	4	1
α-helix	360-366	7
β-strand	374-376	3	1
β-strand	381-386	6	2
α-helix	387-398	12
α-helix	402-406	5
α-helix	407-412	6
β-strand	413-418	6	1
α-helix	431-433	3
β-strand	437-442	6	1
α-helix	443-455	13

Chain B: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	275-281	7	3
β-strand	284-285	2	3
α-helix	288-289	2
β-strand	290-292	3	3
β-strand	296-300	5	4
β-strand	310-312	3	4
α-helix	323-330	8
β-strand	336-341	6	4
β-strand	344-349	6	4
β-strand	355-358	4	3
α-helix	360-366	7
β-strand	374-376	3	3
β-strand	381-386	6	4
α-helix	387-398	12
α-helix	402-406	5
α-helix	407-410	4
β-strand	413-418	6	3
α-helix	431-433	3
β-strand	437-442	6	3
α-helix	443-455	13

Chain C: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	275-281	7	5
β-strand	284-285	2	5
α-helix	288-289	2
β-strand	290-292	3	5
β-strand	296-300	5	6
β-strand	310-312	3	6
α-helix	323-330	8
β-strand	336-341	6	6
β-strand	344-349	6	6
β-strand	355-358	4	5
α-helix	360-365	6
β-strand	374-376	3	5
β-strand	381-386	6	6
α-helix	387-397	11
α-helix	398-400	3
α-helix	402-406	5
α-helix	407-411	5
β-strand	413-418	6	5
α-helix	431-433	3
β-strand	437-442	6	5
α-helix	443-455	13

Chain D: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	765-768	4	7
β-strand	785-789	5	8
α-helix	794-796	3
α-helix	803-813	11
β-strand	820-825	6	8
β-strand	834-838	5	8
α-helix	841-851	11
β-strand	854-856	3	7
β-strand	859-861	3	7
β-strand	862-865	4	8
α-helix	868-874	7
α-helix	876-880	5
α-helix	884-885	2

Chain E: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	765-768	4	9
β-strand	785-789	5	10
α-helix	794-796	3
α-helix	802-813	12
β-strand	820-825	6	10
β-strand	834-838	5	10
α-helix	841-851	11
β-strand	854-856	3	9
β-strand	859-861	3	9
β-strand	862-865	4	10
α-helix	884-885	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mothers against decapentaplegic homolog 2	A, B, C	protein	200	Homo sapiens	Q15796 (AlphaFold model)
Inner nuclear membrane protein Man1	D, E	protein	132	Homo sapiens	Q9Y2U8 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>5ZOJ_1 Mothers against decapentaplegic homolog 2 (chains A, B, C)
GPGDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSN
VNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP
GCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWI
ELHLNGPLQWLDKVLTQMGS

Sequence of entity 2 (D, E), FASTA

>5ZOJ_2 Inner nuclear membrane protein Man1 (chains D, E)
GPGSKVWQGQAFHLDRRNSPPNSLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDND
GIVHIAVDKNSREGCVYVKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQA
LTSNTPLKPSNK

Primary citation

Structural basis for receptor-regulated SMAD recognition by MAN1. Miyazono, K.I., Ohno, Y., Wada, H. et al. Nucleic Acids Res (2018) 46:12139-12153. DOI 10.1093/nar/gky925 · PubMed

Other PDB entries of the same protein (UniProt Q15796 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YIA 1.3 Å, 14-3-3 sigma in complex with SMAD2 pS465 peptide
6M64 1.45 Å, Crystal structure of SMAD2 in complex with CBP
1KHX 1.8 Å, Crystal structure of a phosphorylated Smad2
5XOD 1.85 Å, Crystal structure of human Smad2-Ski complex
6ZVQ 2.03 Å, Complex between SMAD2 MH2 domain and peptide from Ski corepressor
1DEV 2.2 Å, Crystal structure of SMAD2 MH2 domain bound to the smad-binding domain of sara
1U7V 2.7 Å, Crystal Structure of the phosphorylated Smad2/Smad4 heterotrimeric complex
7CO1 3.3 Å, Crystal structure of SMAD2 in complex with wild-type CBP
2LB3 Structure of the WW domain of PIN1 in complex with a human phosphorylated Smad3 derived…

Browse structure collections

About this viewer

MolViewer shows 5ZOJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.