1UA8: Lipoprotein localization factor, LolA

Crystal structure of the lipoprotein localization factor, LolA. Determined by X-ray diffraction at 1.9 Å resolution. Released 15 Jul 2003.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Escherichia coli
Chains: 1
Atoms: 1,474
Mol. weight: 20.34 kDa
Released: 15 Jul 2003

Explore 1UA8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UA8 contains 7 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
β-strand	15-25	11	1
β-strand	35-42	8	1
β-strand	46-53	8	1
β-strand	57-61	5	1
β-strand	65-70	6	1
β-strand	75-80	6	1
α-helix	81-84	4
α-helix	89-95	7
α-helix	98-102	5
β-strand	104-109	6	1
β-strand	112-117	6	1
β-strand	124-131	8	1
β-strand	137-144	8	1
β-strand	149-159	11	1
α-helix	164-167	4
α-helix	171-172	2
α-helix	175	1
β-strand	176-179	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer-membrane lipoproteins carrier protein	A	protein	182	Escherichia coli	P61316 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UA8_1 Outer-membrane lipoproteins carrier protein (chains A)
DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILV
SDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKAS
NGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQ
RK

Primary citation

Crystal structures of bacterial lipoprotein localization factors, LolA and LolB. Takeda, K., Miyatake, H., Yokota, N. et al. EMBO J (2003) 22:3199-3209. DOI 10.1093/emboj/cdg324 · PubMed

Other PDB entries of the same protein (UniProt P61316 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IWL 1.65 Å, Crystal Structure of the Lipoprotein Localization Factor, LolA
3KSN 1.65 Å, Crystal structure of the lipoprotein localization factor, LolA
7Z6W 1.84 Å, Complex of E. coli LolA and lipoprotein
2ZPD 1.85 Å, Crystal structure of the R43L mutant of LolA in the open form
6F3Z 2.0 Å, Complex of E. coli LolA and periplasmic domain of LolC
7Z6X 2.06 Å, Complex of E. coli LolA R43L mutant and lipoprotein
2ZPC 2.35 Å, Crystal structure of the R43L mutant of LolA in the closed form
6FHM 2.39 Å, Crystal structure of the F47E mutant of the lipoprotein localization factor, LolA
7ARM 3.6 Å, LolCDE in complex with lipoprotein and LolA

Browse structure collections

About this viewer

MolViewer shows 1UA8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.