7Z6X: Outer-membrane lipoprotein carrier protein

Complex of E. coli LolA R43L mutant and lipoprotein. Determined by X-ray diffraction at 2.06 Å resolution. Released 7 Sept 2022.

Method: X-ray diffraction
Resolution: 2.06 Å
Organism: Escherichia coli K-12
Chains: 1
Atoms: 1,510
Mol. weight: 22.4 kDa
Ligands: IG7
Released: 7 Sept 2022

Explore 7Z6X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Z6X contains 5 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
β-strand	15-25	11	1
β-strand	31-42	12	1
β-strand	46-53	8	1
β-strand	57-61	5	1
β-strand	65-70	6	1
β-strand	75-80	6	1
α-helix	81-85	5
α-helix	91-94	4
α-helix	98-101	4
β-strand	104-109	6	1
β-strand	112-117	6	1
β-strand	124-131	8	1
β-strand	137-144	8	1
β-strand	149-158	10	1
α-helix	164-167	4
β-strand	176-179	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer-membrane lipoprotein carrier protein	A	protein	192	Escherichia coli K-12	P61316 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7Z6X_1 Outer-membrane lipoprotein carrier protein (chains A)
DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKLPNLFNWHMTQPDESILV
SDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKAS
NGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQ
RKGSWSHPQFEK

Ligands and cofactors

ID	Name	Formula	Copies
IG7	[(2~{S})-3-[(2~{S})-3-azanyl-2-(hexadecanoylamino)-3-oxidanylidene-propyl]sulfa…	C54 H104 N2 O6 S	1

Primary citation

Structural basis of lipoprotein recognition by the bacterial Lol trafficking chaperone LolA. Kaplan, E., Greene, N.P., Jepson, A.E. et al. Proc Natl Acad Sci U S A (2022) 119:e2208662119-e2208662119. DOI 10.1073/pnas.2208662119 · PubMed

Other PDB entries of the same protein (UniProt P61316 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IWL 1.65 Å, Crystal Structure of the Lipoprotein Localization Factor, LolA
3KSN 1.65 Å, Crystal structure of the lipoprotein localization factor, LolA
7Z6W 1.84 Å, Complex of E. coli LolA and lipoprotein
2ZPD 1.85 Å, Crystal structure of the R43L mutant of LolA in the open form
1UA8 1.9 Å, Crystal structure of the lipoprotein localization factor, LolA
6F3Z 2.0 Å, Complex of E. coli LolA and periplasmic domain of LolC
2ZPC 2.35 Å, Crystal structure of the R43L mutant of LolA in the closed form
6FHM 2.39 Å, Crystal structure of the F47E mutant of the lipoprotein localization factor, LolA
7ARM 3.6 Å, LolCDE in complex with lipoprotein and LolA

Browse structure collections

About this viewer

MolViewer shows 7Z6X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.