3KSN: Lipoprotein localization factor, LolA

Crystal structure of the lipoprotein localization factor, LolA. Determined by X-ray diffraction at 1.65 Å resolution. Released 6 Oct 2010.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Escherichia coli
Chains: 1
Atoms: 1,488
Mol. weight: 20.4 kDa
Released: 6 Oct 2010

Explore 3KSN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KSN contains 8 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
β-strand	15-25	11	1
β-strand	34-42	9	1
β-strand	46-53	8	1
β-strand	57-61	5	1
β-strand	65-70	6	1
α-helix	71-73	3
β-strand	75-80	6	1
α-helix	81-83	3
α-helix	89-95	7
α-helix	98-101	4
β-strand	104-109	6	1
β-strand	112-117	6	1
β-strand	124-131	8	1
β-strand	137-144	8	1
β-strand	149-159	11	1
α-helix	164-167	4
α-helix	171-172	2
α-helix	175	1
β-strand	176-179	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer-membrane lipoprotein carrier protein	A	protein	183	Escherichia coli	P61316 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3KSN_1 Outer-membrane lipoprotein carrier protein (chains A)
GDAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESIL
VSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKA
SNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDD
QRK

Primary citation

Crystal structure of the lipoprotein localization factor, LolA. Ahmadpour, F., Gloyd, M., Guarne, A. et al. To be published.

Other PDB entries of the same protein (UniProt P61316 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IWL 1.65 Å, Crystal Structure of the Lipoprotein Localization Factor, LolA
7Z6W 1.84 Å, Complex of E. coli LolA and lipoprotein
2ZPD 1.85 Å, Crystal structure of the R43L mutant of LolA in the open form
1UA8 1.9 Å, Crystal structure of the lipoprotein localization factor, LolA
6F3Z 2.0 Å, Complex of E. coli LolA and periplasmic domain of LolC
7Z6X 2.06 Å, Complex of E. coli LolA R43L mutant and lipoprotein
2ZPC 2.35 Å, Crystal structure of the R43L mutant of LolA in the closed form
6FHM 2.39 Å, Crystal structure of the F47E mutant of the lipoprotein localization factor, LolA
7ARM 3.6 Å, LolCDE in complex with lipoprotein and LolA

Browse structure collections

About this viewer

MolViewer shows 3KSN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.