2ZPC: R43L mutant of LolA in the closed form

Crystal structure of the R43L mutant of LolA in the closed form. Determined by X-ray diffraction at 2.35 Å resolution. Released 5 Aug 2008.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Escherichia coli
Chains: 1
Atoms: 1,424
Mol. weight: 21.37 kDa
Released: 5 Aug 2008

Explore 2ZPC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZPC contains 6 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
β-strand	15-24	10	1
β-strand	33	1	1
β-strand	36-42	7	1
β-strand	46-53	8	1
β-strand	57-62	6	1
β-strand	65-70	6	1
β-strand	75-80	6	1
α-helix	81-83	3
α-helix	89-95	7
α-helix	98-102	5
β-strand	104-109	6	1
β-strand	112-117	6	1
β-strand	124-131	8	1
β-strand	137-144	8	1
β-strand	149-157	9	1
α-helix	164-167	4
α-helix	171-172	2
β-strand	176-179	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer-membrane lipoprotein carrier protein	A	protein	190	Escherichia coli	P61316 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ZPC_1 Outer-membrane lipoprotein carrier protein (chains A)
DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKLPNLFNWHMTQPDESILV
SDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKAS
NGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQ
RKLEHHHHHH

Primary citation

Opening and closing of the hydrophobic cavity of LolA coupled to lipoprotein binding and release. Oguchi, Y., Takeda, K., Watanabe, S. et al. J Biol Chem (2008) 283:25414-25420. DOI 10.1074/jbc.M804736200 · PubMed

Other PDB entries of the same protein (UniProt P61316 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IWL 1.65 Å, Crystal Structure of the Lipoprotein Localization Factor, LolA
3KSN 1.65 Å, Crystal structure of the lipoprotein localization factor, LolA
7Z6W 1.84 Å, Complex of E. coli LolA and lipoprotein
2ZPD 1.85 Å, Crystal structure of the R43L mutant of LolA in the open form
1UA8 1.9 Å, Crystal structure of the lipoprotein localization factor, LolA
6F3Z 2.0 Å, Complex of E. coli LolA and periplasmic domain of LolC
7Z6X 2.06 Å, Complex of E. coli LolA R43L mutant and lipoprotein
6FHM 2.39 Å, Crystal structure of the F47E mutant of the lipoprotein localization factor, LolA
7ARM 3.6 Å, LolCDE in complex with lipoprotein and LolA

Browse structure collections

About this viewer

MolViewer shows 2ZPC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.