6FHM: Outer-membrane lipoprotein carrier protein

Crystal structure of the F47E mutant of the lipoprotein localization factor, LolA. Determined by X-ray diffraction at 2.39 Å resolution. Released 25 Jul 2018.

Method: X-ray diffraction
Resolution: 2.39 Å
Organism: Escherichia coli (strain K12)
Chains: 2
Atoms: 3,053
Mol. weight: 46.11 kDa
Released: 25 Jul 2018

Explore 6FHM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FHM contains 12 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	-5-11	17
β-strand	15-25	11	1
β-strand	33-42	10	1
α-helix	43-47	5
β-strand	48-52	5	2
β-strand	58-61	4	2
β-strand	65-70	6	2
β-strand	75-80	6	2
α-helix	88-95	8
α-helix	98-101	4
β-strand	104-109	6	2
β-strand	112-117	6	2
β-strand	126-131	6	2
β-strand	137-143	7	2
β-strand	149-159	11	2
α-helix	164-167	4
α-helix	171-172	2
β-strand	176-179	4	2

Chain B: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	-1-11	13
β-strand	15-25	11	2
β-strand	31-42	12	2
α-helix	43-47	5
β-strand	48-52	5	1
β-strand	58-61	4	1
β-strand	65-70	6	1
β-strand	75-80	6	1
α-helix	88-95	8
α-helix	98-101	4
β-strand	104-109	6	1
β-strand	112-117	6	1
β-strand	124-131	8	1
β-strand	137-144	8	1
β-strand	149-159	11	1
α-helix	171-172	2
α-helix	175	1
β-strand	176-179	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer-membrane lipoprotein carrier protein	A, B	protein	206	Escherichia coli (strain K12)	P61316 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6FHM_1 Outer-membrane lipoprotein carrier protein (chains A, B)
MGSSHHHHHHSSGLVPRGSHMASMDAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQ
GDLWVKRPNLENWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARN
QSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKS
QQNGAVDAAKFTFTPPQGVTVDDQRK

Primary citation

Insights into bacterial lipoprotein trafficking from a structure of LolA bound to the LolC periplasmic domain. Kaplan, E., Greene, N.P., Crow, A. et al. Proc Natl Acad Sci U S A (2018) 115:E7389-E7397. DOI 10.1073/pnas.1806822115 · PubMed

Other PDB entries of the same protein (UniProt P61316 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IWL 1.65 Å, Crystal Structure of the Lipoprotein Localization Factor, LolA
3KSN 1.65 Å, Crystal structure of the lipoprotein localization factor, LolA
7Z6W 1.84 Å, Complex of E. coli LolA and lipoprotein
2ZPD 1.85 Å, Crystal structure of the R43L mutant of LolA in the open form
1UA8 1.9 Å, Crystal structure of the lipoprotein localization factor, LolA
6F3Z 2.0 Å, Complex of E. coli LolA and periplasmic domain of LolC
7Z6X 2.06 Å, Complex of E. coli LolA R43L mutant and lipoprotein
2ZPC 2.35 Å, Crystal structure of the R43L mutant of LolA in the closed form
7ARM 3.6 Å, LolCDE in complex with lipoprotein and LolA

Browse structure collections

About this viewer

MolViewer shows 6FHM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.