human VASP tetramerisation domain. Determined by X-ray diffraction at 1.3 Å resolution. Released 11 Nov 2004.
Explore 1USE in 3D Show helices and sheets RCSB PDB PDBe
1USE contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 341-376 | 36 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Vasodilator-stimulated phosphoprotein | A | protein | 45 | HOMO SAPIENS | P50552 (AlphaFold model) |
>1USE_1 VASODILATOR-STIMULATED PHOSPHOPROTEIN (chains A) PSSSDYSDLQRVKQELLEEVKKELQKVKEEIIEAFVQELRKRGSP
The Vasp Tetramerization Domain is a Right-Handed Coiled Coil Based on a 15-Residue Repeat. Kuhnel, K., Jarchau, T., Wolf, E. et al. Proc Natl Acad Sci U S A (2004) 101:17027. DOI 10.1073/PNAS.0403069101 · PubMed
Other PDB entries of the same protein (UniProt P50552 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1USE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.