1VF9: Human Trf2

Solution Structure Of Human Trf2. Determined by solution NMR. Released 17 May 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 529
Mol. weight: 7.55 kDa
Released: 17 May 2005

Explore 1VF9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1VF9 contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	452-465	14
α-helix	470-476	7
α-helix	485-493	9
α-helix	494-498	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Telomeric repeat binding factor 2	A	protein	64	Homo sapiens	Q15554 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1VF9_1 Telomeric repeat binding factor 2 (chains A)
MEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKR
LGMN

Primary citation

Comparison between TRF2 and TRF1 of their telomeric DNA-bound structures and DNA-binding activities. Hanaoka, S., Nagadoi, A., Nishimura, Y. Protein Sci (2005) 14:119-130. DOI 10.1110/ps.04983705 · PubMed

Other PDB entries of the same protein (UniProt Q15554 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SJM 1.35 Å, Crystal Structure Analysis of TRF2-Dbd-DNA complex
1W0U 1.8 Å, hTRF2 DNA-binding domain in complex with telomeric DNA.
3K6G 1.95 Å, Crystal structure of Rap1 and TRF2 complex
4M7C 2.05 Å, Crystal structure of the TRF2-binding motif of SLX4 in complex with the TRFH domain of…
6J67 2.05 Å, Crystal structure of the compound 34 in a complex with TRF2
3BU8 2.15 Å, Crystal Structure of TRF2 TRFH domain and TIN2 peptide complex
7C5D 2.15 Å, Crystal structure of TRF2 TRFH domain in complex with a MCPH1 peptide
1H6P 2.2 Å, Dimeristion domain from human TRF2
5XYF 2.2 Å, Crystal structure of the human TIN2-TPP1-TRF2 telomeric complex
4RQI 2.44 Å, Structure of TRF2/RAP1 secondary interaction binding site
3BUA 2.5 Å, Crystal Structure of TRF2 TRFH domain and APOLLO peptide complex
9Q9K 2.59 Å, Cryo-EM structure of human Mre11-Rad50 (MR) complex bound to DNA and telomeric factor…

Browse structure collections

About this viewer

MolViewer shows 1VF9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.