Structure of iib domain of the mannitol-specific permease enzyme II. Determined by solution NMR. Released 21 Sept 2004.
Explore 1VKR in 3D Show helices and sheets RCSB PDB PDBe
1VKR contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 379-382 | 4 | 1 |
| α-helix | 389-404 | 16 | |
| β-strand | 411-414 | 4 | 1 |
| β-strand | 426-430 | 5 | 1 |
| α-helix | 431-440 | 10 | |
| β-strand | 445-449 | 5 | 1 |
| α-helix | 455-470 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| mannitol-specific PTS system enzyme IIABC components | A | protein | 125 | Escherichia coli | P00550 (AlphaFold model) |
>1VKR_1 mannitol-specific PTS system enzyme IIABC components (chains A) GSAGDVTNDLSHVRKIIVACDAGMGSSAMGAGVLRKKIQDAGLSQISVTNSAINNLPPDV DLVITHRDLTERAMRQVPQAQHISLTNFLDSGLYTSLTERLVAAQRHTENEVKVKDSLKD SFDDS
Three-dimensional Solution Structure of the Cytoplasmic B Domain of the Mannitol Transporter II-Mannitol of the Escherichia coli Phosphotransferase System. Legler, P.M., Cai, M., Peterkofsky, A. et al. J Biol Chem (2004) 279:39115-39121. DOI 10.1074/jbc.M406764200 · PubMed
Other PDB entries of the same protein (UniProt P00550 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1VKR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.