Crystal Structure Of Myosin V Motor With Essential Light Chain + ADP-BeFx - Near Rigor. Determined by X-ray diffraction at 2.0 Å resolution. Released 22 Feb 2005.
Explore 1W7J in 3D Show helices and sheets RCSB PDB PDBe
1W7J contains 51 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| β-strand | 12-17 | 6 | 1 |
| β-strand | 21-27 | 7 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-51 | 5 | 1 |
| α-helix | 52-53 | 2 | |
| α-helix | 59-61 | 3 | |
| β-strand | 62 | 1 | 1 |
| α-helix | 63-65 | 3 | |
| α-helix | 66-68 | 3 | |
| α-helix | 82-90 | 9 | |
| α-helix | 91-95 | 5 | |
| α-helix | 96 | 1 | |
| β-strand | 100-103 | 4 | 2 |
| β-strand | 106-110 | 5 | 2 |
| α-helix | 121-127 | 7 | |
| α-helix | 132-134 | 3 | |
| α-helix | 139-153 | 15 | |
| β-strand | 157-162 | 6 | 2 |
| α-helix | 169-183 | 15 | |
| α-helix | 192-207 | 16 | |
| β-strand | 208-209 | 2 | 3 |
| β-strand | 217-218 | 2 | 3 |
| β-strand | 221-228 | 8 | 2 |
| β-strand | 234-242 | 9 | 2 |
| α-helix | 246-249 | 4 | |
| β-strand | 259 | 1 | 3 |
| α-helix | 260-267 | 8 | |
| α-helix | 272-277 | 6 | |
| α-helix | 286-289 | 4 | |
| α-helix | 301-314 | 14 | |
| α-helix | 319-336 | 18 | |
| β-strand | 341-344 | 4 | 4 |
| β-strand | 347-349 | 3 | 4 |
| α-helix | 350-351 | 2 | |
| α-helix | 355-364 | 10 | |
| α-helix | 368-375 | 8 | |
| β-strand | 377-381 | 5 | 5 |
| β-strand | 386-390 | 5 | 5 |
| α-helix | 393-423 | 31 | |
| α-helix | 428-429 | 2 | |
| β-strand | 431-437 | 7 | 2 |
| α-helix | 449-479 | 31 | |
| α-helix | 484-486 | 3 | |
| α-helix | 493-500 | 8 | |
| α-helix | 505-513 | 9 | |
| α-helix | 520-531 | 12 | |
| β-strand | 538-539 | 2 | 6 |
| β-strand | 547-551 | 5 | 6 |
| β-strand | 556-560 | 5 | 6 |
| α-helix | 564-569 | 6 | |
| α-helix | 574-581 | 8 | |
| α-helix | 588-591 | 4 | |
| α-helix | 636-652 | 17 | |
| β-strand | 655-662 | 8 | 2 |
| α-helix | 675-684 | 10 | |
| α-helix | 687-696 | 10 | |
| β-strand | 700-703 | 4 | 7 |
| α-helix | 704-711 | 8 | |
| α-helix | 712-714 | 3 | |
| α-helix | 717-719 | 3 | |
| α-helix | 724-735 | 12 | |
| α-helix | 739-741 | 3 | |
| β-strand | 742-744 | 3 | 7 |
| β-strand | 748-751 | 4 | 7 |
| α-helix | 755-791 | 37 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-19 | 8 | |
| β-strand | 26-28 | 3 | 8 |
| α-helix | 32-38 | 7 | |
| α-helix | 45-51 | 7 | |
| α-helix | 57-60 | 4 | |
| β-strand | 64-66 | 3 | 8 |
| α-helix | 67-77 | 11 | |
| α-helix | 90-94 | 5 | |
| β-strand | 103-105 | 3 | 9 |
| α-helix | 106-115 | 10 | |
| α-helix | 119-121 | 3 | |
| α-helix | 122-129 | 8 | |
| β-strand | 138-140 | 3 | 9 |
| α-helix | 141-147 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myosin va | A | protein | 795 | GALLUS GALLUS | Q02440 (AlphaFold model) |
| Myosin light chain 1 | B | protein | 151 | HOMO SAPIENS | P14649 (AlphaFold model) |
>1W7J_1 MYOSIN VA (chains A) MAASELYTKYARVWIPDPEEVWKSAELLKDYKPGDKVLQLRLEEGKDLEYCLDPKTKELP PLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLPIYG EDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF ATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMR TYLLEKSRVVFQAEEERNYHIFYQLCASAALPEFKTLRLGNANYFHYTKQGGSPVIDGID DAKEMVNTRQACTLLGISDSYQMGIFRILAGILHLGNVEFASRDSDSCAIPPKHDPLTIF CDLMGVDYEEMAHWLCHRKLATATETYIKPISKLHAINARDALAKHIYANLFNWIVDHVN KALHSTVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKE QIPWTLIDFYDNQPCINLIEAKMGVLDLLDEECKMPKGSDDTWAQKLYNTHLNKCALFEK PRLSNKAFIIKHFADKVEYQCEGFLEKNKDTVYEEQIKVLKSSKKFKLLPELFQDEEKAI SPTSATPSGRVPLSRTPVKPAKARPGQTSKEHKKTVGHQFRNSLHLLMETLNATTPHYVR CIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDV LSDRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRADKLRAACIRIQKTIRG WLMRKKYMRMRRGDA
>1W7J_2 MYOSIN LIGHT CHAIN 1 (chains B) MIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEL KSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKM TEEEVETVLAGHEDSNGCINYEAFLKHILSV
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 1 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
| BEF | Beryllium trifluoride ion | Be F3 | 1 |
Three Myosin V Structures Delineate Essential Features of Chemo-Mechanical Transduction. Coureux, P.-D., Sweeney, H.L., Houdusse, A. EMBO J (2004) 23:4527. DOI 10.1038/SJ.EMBOJ.7600458 · PubMed
Other PDB entries of the same protein (UniProt Q02440 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1W7J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.