Structural characterization of the MIT domain from human Vps4b. Determined by solution NMR. Released 2 Aug 2005.
Explore 1WR0 in 3D Show helices and sheets RCSB PDB PDBe
1WR0 contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-27 | 18 | |
| α-helix | 34-51 | 18 | |
| α-helix | 56-59 | 4 | |
| α-helix | 60-76 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SKD1 protein | A | protein | 81 | Homo sapiens | O75351 (AlphaFold model) |
>1WR0_1 SKD1 protein (chains A) GSDHMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQ SIRAKCTEYLDRAEKLKEYLK
Structural characterization of the MIT domain from human Vps4b. Takasu, H., Jee, J.G., Ohno, A. et al. Biochem Biophys Res Commun (2005) 334:460-465. DOI 10.1016/j.bbrc.2005.06.110 · PubMed
Other PDB entries of the same protein (UniProt O75351 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1WR0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.