1WR0: SKD1 protein

Structural characterization of the MIT domain from human Vps4b. Determined by solution NMR. Released 2 Aug 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 647
Mol. weight: 9.21 kDa
Released: 2 Aug 2005

Explore 1WR0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WR0 contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	10-27	18
α-helix	34-51	18
α-helix	56-59	4
α-helix	60-76	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SKD1 protein	A	protein	81	Homo sapiens	O75351 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WR0_1 SKD1 protein (chains A)
GSDHMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQ
SIRAKCTEYLDRAEKLKEYLK

Primary citation

Structural characterization of the MIT domain from human Vps4b. Takasu, H., Jee, J.G., Ohno, A. et al. Biochem Biophys Res Commun (2005) 334:460-465. DOI 10.1016/j.bbrc.2005.06.110 · PubMed

Other PDB entries of the same protein (UniProt O75351 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4U7Y 2.5 Å, Structure of the complex of VPS4B MIT and IST1 MIM
1XWI 2.8 Å, Crystal Structure of VPS4B
7L9X 2.81 Å, Structure of VPS4B in complex with an allele-specific covalent inhibitor
2CPT Solution structure of MIT domain from human SKD1
2JQH VPS4B mit
2JQK VPS4B MIT-CHMP2B Complex

Browse structure collections

About this viewer

MolViewer shows 1WR0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.