1XWI: VPS4B

Crystal Structure of VPS4B. Determined by X-ray diffraction at 2.8 Å resolution. Released 11 Oct 2005.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,527
Mol. weight: 35.87 kDa
Released: 11 Oct 2005

Explore 1XWI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XWI contains 19 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	125-127	3	1
α-helix	133-135	3
α-helix	140-146	7
α-helix	147-151	5
α-helix	152-155	4
α-helix	157-159	3
β-strand	169-173	5	1
α-helix	180-190	11
β-strand	195-200	6	1
α-helix	213-225	13
β-strand	229-234	6	1
α-helix	238-240	3
α-helix	250-263	14
β-strand	272-278	7	1
α-helix	286-290	5
β-strand	294-297	4	1
α-helix	303-314	12
β-strand	319	1	2
α-helix	323-331	9
α-helix	338-349	12
α-helix	351-358	8
β-strand	361-368	8	3
β-strand	376-383	8	3
β-strand	391-393	3	3
α-helix	396-398	3
α-helix	401-403	3
β-strand	404	1	3
α-helix	406-408	3
β-strand	409	1	2
α-helix	411-419	9
α-helix	427-438	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SKD1 protein	A	protein	322	Homo sapiens	O75351 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1XWI_1 SKD1 protein (chains A)
AIVIERPNVKWSDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSY
LAKAVATEANNSTFFSISSSDLVSKWLGESEKLVKNLFQLARENKPSIIFIDEIDSLCGS
RSENESEAARRIKTEFLVQMQGVGVDNDGILVLGATNIPWVLDSAIRRRFEKRIYIPLPE
PHARAAMFKLHLGTTQNSLTEADFRELGRKTDGYSGADISIIVRDALMQPVRKVQSATHF
KKVRGPSRADPNHLVDDLLTPCSPGDPGAIEMTWMDVPGDKLLEPVVSMSDMLRSLSNTK
PTVNEHDLLKLKKFTEDFGQEG

Primary citation

Structural and mechanistic studies of VPS4 proteins. Scott, A., Chung, H.Y., Gonciarz-Swiatek, M. et al. EMBO J (2005) 24:3658-3669. DOI 10.1038/sj.emboj.7600818 · PubMed

Other PDB entries of the same protein (UniProt O75351 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4U7Y 2.5 Å, Structure of the complex of VPS4B MIT and IST1 MIM
7L9X 2.81 Å, Structure of VPS4B in complex with an allele-specific covalent inhibitor
1WR0 Structural characterization of the MIT domain from human Vps4b
2CPT Solution structure of MIT domain from human SKD1
2JQH VPS4B mit
2JQK VPS4B MIT-CHMP2B Complex

Browse structure collections

About this viewer

MolViewer shows 1XWI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.