2CPT: MIT domain from human SKD1

Solution structure of MIT domain from human SKD1. Determined by solution NMR. Released 19 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 888
Mol. weight: 12.67 kDa
Released: 19 Nov 2005

Explore 2CPT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CPT contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	13-31	19
α-helix	34-53	20
α-helix	59-86	28
α-helix	90-93	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar sorting protein 4b	A	protein	117	Homo sapiens	O75351 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CPT_1 Vacuolar sorting protein 4b (chains A)
GSSGSSGMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDK
AKQSIRAKCTEYLDRAEKLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGSGPSSG

Primary citation

Solution structure of MIT domain from human SKD1. Suetake, T., Hayashi, F., Yokoyama, S. To be published.

Other PDB entries of the same protein (UniProt O75351 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4U7Y 2.5 Å, Structure of the complex of VPS4B MIT and IST1 MIM
1XWI 2.8 Å, Crystal Structure of VPS4B
7L9X 2.81 Å, Structure of VPS4B in complex with an allele-specific covalent inhibitor
1WR0 Structural characterization of the MIT domain from human Vps4b
2JQH VPS4B mit
2JQK VPS4B MIT-CHMP2B Complex

Browse structure collections

About this viewer

MolViewer shows 2CPT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.