4U7Y: Complex of VPS4B MIT and IST1 MIM

Structure of the complex of VPS4B MIT and IST1 MIM. Determined by X-ray diffraction at 2.5 Å resolution. Released 11 Feb 2015.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 722
Mol. weight: 13.32 kDa
Released: 11 Feb 2015

Explore 4U7Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U7Y contains 5 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	3-5	3
α-helix	6-24	19
α-helix	27-47	21
α-helix	52-82	31

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	322-330	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar protein sorting-associated protein 4B	A	protein	90	Homo sapiens	O75351 (AlphaFold model)
IST1 homolog	B	protein	25	Homo sapiens	P53990 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4U7Y_1 Vacuolar protein sorting-associated protein 4B (chains A)
SMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIR
AKCTEYLDRAEKLKEYLKNKEKKAQKPVKE

Sequence of entity 2 (B), FASTA

>4U7Y_2 IST1 homolog (chains B)
STSASEDIDFDDLSRRFEELKKKTW

Primary citation

Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains. Guo, E.Z., Xu, Z. J Biol Chem (2015) 290:8396-8408. DOI 10.1074/jbc.M114.607903 · PubMed

Other PDB entries of the same protein (UniProt O75351 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1XWI 2.8 Å, Crystal Structure of VPS4B
7L9X 2.81 Å, Structure of VPS4B in complex with an allele-specific covalent inhibitor
1WR0 Structural characterization of the MIT domain from human Vps4b
2CPT Solution structure of MIT domain from human SKD1
2JQH VPS4B mit
2JQK VPS4B MIT-CHMP2B Complex

Browse structure collections

About this viewer

MolViewer shows 4U7Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.