2JQK: VPS4B MIT-CHMP2B Complex

VPS4B MIT-CHMP2B Complex. Determined by solution NMR. Released 16 Oct 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 699
Mol. weight: 12.31 kDa
Released: 16 Oct 2007

Explore 2JQK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JQK contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	11-27	17
α-helix	31-49	19
α-helix	55-80	26

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	117-126	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar protein sorting-associating protein 4B	A	protein	89	Homo sapiens	O75351 (AlphaFold model)
Charged multivesicular body protein 2b	B	protein	19	Homo sapiens	Q9UQN3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JQK_1 Vacuolar protein sorting-associating protein 4B (chains A)
GHMMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQS
IRAKCTEYLDRAEKLKEYLKNKEKKAQKP

Sequence of entity 2 (B), FASTA

>2JQK_2 Charged multivesicular body protein 2b (chains B)
KATISDEEIERQLKALGVD

Primary citation

ESCRT-III recognition by VPS4 ATPases. Stuchell-Brereton, M.D., Skalicky, J.J., Kieffer, C. et al. Nature (2007) 449:740-744. DOI 10.1038/nature06172 · PubMed

Other PDB entries of the same protein (UniProt O75351 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4U7Y 2.5 Å, Structure of the complex of VPS4B MIT and IST1 MIM
1XWI 2.8 Å, Crystal Structure of VPS4B
7L9X 2.81 Å, Structure of VPS4B in complex with an allele-specific covalent inhibitor
1WR0 Structural characterization of the MIT domain from human Vps4b
2CPT Solution structure of MIT domain from human SKD1
2JQH VPS4B mit

Browse structure collections

About this viewer

MolViewer shows 2JQK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.