1WZ0: Human SUMO-2 (SMT3B), a Ubiquitin-like Protein

Solution Structure of Human SUMO-2 (SMT3B), a Ubiquitin-like Protein. Determined by solution NMR. Released 21 Aug 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 802
Mol. weight: 11.5 kDa
Released: 21 Aug 2005

Explore 1WZ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WZ0 contains 1 α-helix and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	25-30	6	1
β-strand	36-41	6	1
α-helix	47-58	12
β-strand	67-68	2	1
β-strand	73	1	1
β-strand	89-93	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like protein SMT3B	A	protein	104	Homo sapiens	P61956 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WZ0_1 Ubiquitin-like protein SMT3B (chains A)
GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGL
SMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG

Primary citation

Solution Structure of Human SUMO-2 (SMT3B), a Ubiquitin-like Protein. Zhao, C., Saito, K., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt P61956 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WM3 1.2 Å, Crystal structure of human SUMO-2 protein
1WM2 1.6 Å, Crystal structure of human SUMO-2 protein
4NPN 1.63 Å, Crystal structure of human tetra-SUMO-2
7P99 1.8 Å, Structure of human USPL1 in complex with SUMO2
2D07 2.1 Å, Crystal Structure of SUMO-3-modified Thymine-DNA Glycosylase
4BKG 2.11 Å, crystal structure of human diSUMO-2
3ZO5 2.15 Å, Structure of SENP2-Loop1 in complex with preSUMO-2
2IO0 2.3 Å, Crystal structure of human Senp2 in complex with preSUMO-2
5ELU 2.35 Å, Isoform-specific inhibition of SUMO-dependent protein-protein interactions
5D2M 2.4 Å, Complex between human SUMO2-RANGAP1, UBC9 and ZNF451
7ZJV 2.4 Å, Structure of human USPL1 in covalent complex with DeltaN-SUMO2/3-PA probe
5EQL 2.49 Å, Isoform-specific inhibition of SUMO-dependent protein-protein interactions

Browse structure collections

About this viewer

MolViewer shows 1WZ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.