Crystal Structure of the RNA-dependent RNA Polymerase 3D from human rhinovirus serotype 14. Determined by X-ray diffraction at 2.8 Å resolution. Released 26 Oct 2004.
Explore 1XR5 in 3D Show helices and sheets RCSB PDB PDBe
1XR5 contains 31 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-7 | 6 | 1 |
| α-helix | 9-12 | 4 | |
| β-strand | 26-27 | 2 | 2 |
| α-helix | 29-31 | 3 | |
| β-strand | 39-40 | 2 | 3 |
| α-helix | 41-42 | 2 | |
| α-helix | 54-59 | 6 | |
| α-helix | 70-71 | 2 | |
| α-helix | 72-86 | 15 | |
| α-helix | 93-96 | 4 | |
| α-helix | 97-102 | 6 | |
| α-helix | 120-123 | 4 | |
| α-helix | 127-130 | 4 | |
| α-helix | 139-148 | 10 | |
| β-strand | 154-158 | 5 | 1 |
| β-strand | 162-163 | 2 | 3 |
| α-helix | 165-169 | 5 | |
| β-strand | 175-178 | 4 | 1 |
| α-helix | 179-180 | 2 | |
| α-helix | 181-187 | 7 | |
| α-helix | 192-200 | 9 | |
| β-strand | 203 | 1 | 4 |
| β-strand | 208 | 1 | 4 |
| α-helix | 214-217 | 4 | |
| α-helix | 218-220 | 3 | |
| α-helix | 221-224 | 4 | |
| β-strand | 230-232 | 3 | 4 |
| β-strand | 233-234 | 2 | 5 |
| α-helix | 238-240 | 3 | |
| α-helix | 243-256 | 14 | |
| α-helix | 263-268 | 6 | |
| β-strand | 270-273 | 4 | 1 |
| β-strand | 278-282 | 5 | 1 |
| α-helix | 292-311 | 20 | |
| α-helix | 317-319 | 3 | |
| β-strand | 321-325 | 5 | 4 |
| β-strand | 328-332 | 5 | 4 |
| α-helix | 339-346 | 8 | |
| β-strand | 353-354 | 2 | 5 |
| α-helix | 355-356 | 2 | |
| β-strand | 372 | 1 | 6 |
| β-strand | 375 | 1 | 6 |
| β-strand | 376-379 | 4 | 7 |
| β-strand | 387-390 | 4 | 7 |
| α-helix | 393-400 | 8 | |
| β-strand | 402-403 | 2 | 2 |
| α-helix | 409-420 | 12 | |
| α-helix | 421-423 | 3 | |
| α-helix | 425-435 | 11 | |
| α-helix | 439-443 | 5 | |
| α-helix | 449-458 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Genome polyprotein | A | protein | 466 | Human rhinovirus 14 | P03303 (AlphaFold model) |
>1XR5_1 Genome polyprotein (chains A) GQVIARHKVREFNINPVNTPTKSKLHPSVFYDVFPGDKEPAVLSDNDPRLEVKLTESLFS KYKGNVNTEPTENMLVAVDHYAGQLLSLDIPTSELTLKEALYGVDGLEPIDITTSAGFPY VSLGIKKRDILNKETQDTEKMKFYLDKYGIDLPLVTYIKDELRSVDKVRLGKSRLIEASS LNDSVNMRMKLGNLYKAFHQNPGVLTGSAVGCDPDVFWSVIPCLMDGHLMAFDYSNFDAS LSPVWFVCLEKVLTKLGFAGSSLIQSICNTHHIFRDEIYVVEGGMPSGCSGTSIFNSMIN NIIIRTLILDAYKGIDLDKLKILAYGDDLIVSYPYELDPQVLATLGKNYGLTITPPDKSE TFTKMTWENLTFLKRYFKPDQQFPFLVHPVMPMKDIHESIRWTKDPKNTQDHVRSLCMLA WHSGEKEYNEFIQKIRTTDIGKCLILPEYSVLRRRWLDLFHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| SM | Samarium (III) ion | Sm | 1 |
The Crystal Structure of the RNA-Dependent RNA Polymerase from Human Rhinovirus: A Dual-Function Target for Common Cold Antiviral Therapy. Love, R.A., Maegley, K.A., Yu, X. et al. Structure (2004) 12:1533-1544. DOI 10.1016/j.str.2004.05.024 · PubMed
Other PDB entries of the same protein (UniProt P03303 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1XR5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.