1XW3: Human Sulfiredoxin

Crystal Structure of Human Sulfiredoxin (Srx). Determined by X-ray diffraction at 1.65 Å resolution. Released 24 May 2005.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Homo sapiens
Chains: 1
Atoms: 985
Mol. weight: 12.25 kDa
Ligands: PO4
Released: 24 May 2005

Explore 1XW3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XW3 contains 8 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	39-45	7	1
α-helix	46-48	3
β-strand	49-50	2	1
α-helix	54-56	3
α-helix	59-71	13
α-helix	73-75	3
α-helix	77-78	2
β-strand	79-85	7	1
β-strand	91-94	4	1
α-helix	99-107	9
β-strand	112-120	9	1
α-helix	122-129	8
α-helix	130-132	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sulfiredoxin	A	protein	110	Homo sapiens	Q9BYN0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1XW3_1 SULFIREDOXIN (chains A)
GPHMSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGA
QGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (MPD) are not listed.

Primary citation

Structural basis for the retroreduction of inactivated peroxiredoxins by human sulfiredoxin. Jonsson, T.J., Murray, M.S., Johnson, L.C. et al. Biochemistry (2005) 44:8634-8642. DOI 10.1021/bi050131i · PubMed

Other PDB entries of the same protein (UniProt Q9BYN0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CYI 1.8 Å, Crystal Structure of Human Sulfiredoxin (Srx) in Complex with ATP:Mg2+
1XW4 2.0 Å, Crystal Structure of Human Sulfiredoxin (Srx) in Complex with ADP
3HY2 2.1 Å, Crystal Structure of Sulfiredoxin in Complex with Peroxiredoxin I and ATP:Mg2+
2RII 2.6 Å, Crystal Structure of Human Peroxiredoxin I in complex with Sulfiredoxin
7LJ1 2.97 Å, Human Prx1-Srx Decameric Complex
1YZS Solution structure of human sulfiredoxin (srx)
2B6F Solution structure of human sulfiredoxin (SRX)

Browse structure collections

About this viewer

MolViewer shows 1XW3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.