1XWJ: Vinculin head

Vinculin head (1-258) in complex with the talin vinculin binding site 3 (1945-1969). Determined by X-ray diffraction at 2.6 Å resolution. Released 11 Oct 2005.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Gallus gallus
Chains: 2
Atoms: 2,144
Mol. weight: 34.23 kDa
Released: 11 Oct 2005

Explore 1XWJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XWJ contains 10 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	5	1	1
α-helix	6-25	20
α-helix	40-61	22
α-helix	67-72	6
α-helix	74-96	23
α-helix	101-144	44
α-helix	153-180	28
β-strand	181	1	1
α-helix	184-214	31
α-helix	222-247	26

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1949-1967	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vinculin	A	protein	280	Gallus gallus	P12003 (AlphaFold model)
Talin	B	protein	26		P54939 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1XWJ_1 Vinculin (chains A)
MGSSHHHHHHSSGLVPRGSHMMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPD
LTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADP
YSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVT
YTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTK
SQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWA

Sequence of entity 2 (B), FASTA

>1XWJ_2 Talin (chains B)
YTKKELIESARKVSEKVSHVLAALQA

Primary citation

Structural and Dynamic Characterization of a Vinculin Binding Site in the Talin Rod. Gingras, A.R., Vogel, K.P., Steinhoff, H.J. et al. Biochemistry (2006) 45:1805-1817. DOI 10.1021/bi052136l · PubMed

Other PDB entries of the same protein (UniProt P12003 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QKR 1.8 Å, Crystal structure of the vinculin tail and a pathway for activation
1ZVZ 1.8 Å, Vinculin Head (0-258) in Complex with the Talin Rod Residue 820-844
1T01 2.06 Å, Vinculin complexed with the VBS1 helix from talin
1ZW2 2.1 Å, Vinculin Head (0-258) in Complex with the Talin Rod residues 2345-2369
3ZDL 2.3 Å, Vinculin head (1-258) in complex with a RIAM fragment
4E17 2.3 Å, Alpha-E-catenin is an autoinhibited molecule that co-activates vinculin
1U6H 2.38 Å, Vinculin head (0-258) in complex with the talin vinculin binding site 2 (849-879)
4E18 2.4 Å, Alpha-E-catenin is an autoinhibited molecule that co-activates vinculin
2GDC 2.74 Å, Structure of Vinculin VD1 / IpaA560-633 complex
6FQ4 2.89 Å, Structure of Chlamydial virulence factor TarP and vinculin head domain
6NR7 3.0 Å, Rerefinement of chicken vinculin
1ST6 3.1 Å, Crystal structure of a cytoskeletal protein

Browse structure collections

About this viewer

MolViewer shows 1XWJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.