1Y6K: Human IL-10

Crystal structure of human IL-10 complexed with the soluble IL-10R1 chain. Determined by X-ray diffraction at 2.52 Å resolution. Released 20 Dec 2005.

Method: X-ray diffraction
Resolution: 2.52 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,888
Mol. weight: 43.18 kDa
Released: 20 Dec 2005

Explore 1Y6K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Y6K contains 19 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain L: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	20-40	21
α-helix	50-57	8
α-helix	61-71	11
α-helix	72-76	5
α-helix	77-83	7
α-helix	85-107	23
α-helix	109-111	3
α-helix	113-115	3
α-helix	116-118	3
α-helix	119-129	11
α-helix	133-140	8
α-helix	143-154	12

Chain R: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	11-16	6	1
β-strand	19-24	6	1
α-helix	25-27	3
β-strand	35-42	8	2
β-strand	49-55	7	2
β-strand	59-61	3	1
α-helix	63-66	4
α-helix	69-71	3
β-strand	75-83	9	2
β-strand	86-87	2	2
β-strand	91-92	2	2
β-strand	97	1	2
α-helix	99-101	3
β-strand	102-103	2	1
β-strand	104	1	3
β-strand	108-113	6	4
β-strand	117-123	7	4
α-helix	136-139	4
β-strand	144-153	10	5
β-strand	160-164	5	5
β-strand	168-172	5	4
β-strand	179-188	10	5
β-strand	195	1	3
α-helix	197-200	4
β-strand	201-204	4	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-10	L	protein	160	Homo sapiens	P22301 (AlphaFold model)
Interleukin-10 receptor alpha chain	R	protein	214	Homo sapiens	Q13651 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1Y6K_1 Interleukin-10 (chains L)
SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYL
GCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKA
VEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Sequence of entity 2 (R), FASTA

>1Y6K_2 Interleukin-10 receptor alpha chain (chains R)
HGTELPSPPSVWFEAEFFHHILHWTPIPQQSESTCYEVALLRYGIESWNSISQCSQTLSY
DLTAVTLDLYHSNGYRARVRAVDGSRHSQWTVTNTRFSVDEVTLTVGSVNLEIHNGFILG
KIQLPRPKMAPAQDTYESIFSHFREYEIAIRKVPGQFTFTHKKVKHEQFSLLTSGEVGEF
CVQVKPSVASRSNKGMWSKEECISLTRQYFTVTN

Primary citation

Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Yoon, S.I., Jones, B.C., Logsdon, N.J. et al. Structure (2005) 13:551-564. DOI 10.1016/j.str.2005.01.016 · PubMed

Other PDB entries of the same protein (UniProt P22301 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ILK 1.6 Å, Crystal structure of human interleukin-10 at 1.6 Å resolution
1ILK 1.8 Å, Interleukin-10 crystal structure reveals the functional dimer with an unexpected…
1LK3 1.91 Å, Engineered human interleukin-10 monomer complexed to 9D7 FAB fragment
1INR 2.0 Å, Cytokine synthesis
2H24 2.0 Å, Crystal structure of human IL-10
8SVE 2.4 Å, Structure of Monomeric Interleukin-10 Grafted into and Antibody CDR
1J7V 2.9 Å, Human il-10 / il-10R1 complex
6X93 3.5 Å, Interleukin-10 signaling complex with IL-10RA and IL-10RB

Browse structure collections

About this viewer

MolViewer shows 1Y6K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.