6X93: Interleukin-10

Interleukin-10 signaling complex with IL-10RA and IL-10RB. Determined by electron microscopy at 3.5 Å resolution. Released 17 Mar 2021.

Method: Electron microscopy
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 6
Atoms: 6,846
Mol. weight: 133.54 kDa
Released: 17 Mar 2021

Explore 6X93 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6X93 contains 44 α-helices and 75 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	15-17	3
α-helix	19-40	22
α-helix	51-54	4
α-helix	63-70	8
α-helix	71-76	6
α-helix	77-83	7
α-helix	89-106	18
α-helix	126-130	5
α-helix	132-138	7
α-helix	143-159	17

Chain B: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	11-16	6	1
β-strand	19-24	6	1
α-helix	25-27	3
β-strand	34-42	9	2
β-strand	49-55	7	2
β-strand	59-61	3	1
α-helix	66-68	3
β-strand	75-83	9	2
β-strand	86-92	7	2
β-strand	97	1	2
α-helix	99-101	3
α-helix	102	1
β-strand	103	1	1
α-helix	104	1
β-strand	108	1	3
β-strand	112-113	2	4
β-strand	118-119	2	4
β-strand	120-121	2	5
β-strand	123	1	3
α-helix	136-139	4
β-strand	145-152	8	6
β-strand	161-164	4	6
β-strand	168-169	2	5
α-helix	172-175	4
β-strand	179-187	9	6
β-strand	201-204	4	6

Chain C: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	30	1	7
α-helix	32-34	3
β-strand	37	1	7
β-strand	52-53	2	8
β-strand	55	1	9
β-strand	64	1	9
β-strand	75	1	7
β-strand	85	1	10
β-strand	90-92	3	8
β-strand	97-98	2	8
β-strand	105	1	10
α-helix	114-116	3
β-strand	117-120	4	11
β-strand	128-132	5	11
β-strand	135-136	2	12
β-strand	143-144	2	12
α-helix	145-148	4
β-strand	155-156	2	13
β-strand	176-177	2	11
β-strand	191-192	2	13
β-strand	194	1	14
β-strand	201	1	14
α-helix	202-204	3

Chain D: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	15-40	26
α-helix	51-54	4
α-helix	59-70	12
α-helix	71-76	6
α-helix	77-83	7
α-helix	89-104	16
α-helix	120-130	11
α-helix	132-138	7
α-helix	143-159	17

Chain E: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	10-12	3	15
β-strand	15-16	2	16
β-strand	19-20	2	16
β-strand	23-25	3	15
α-helix	26-27	2
β-strand	34-43	10	17
β-strand	45	1	17
β-strand	49-50	2	17
β-strand	55	1	17
α-helix	63-66	4
α-helix	67-69	3
β-strand	74-83	10	17
β-strand	86-87	2	17
α-helix	88-90	3
β-strand	91-92	2	17
α-helix	103-104	2
β-strand	108	1	18
β-strand	112-113	2	19
β-strand	118-119	2	19
β-strand	120-121	2	20
β-strand	123	1	18
α-helix	136-139	4
β-strand	145-152	8	21
β-strand	161-164	4	21
β-strand	168-169	2	20
α-helix	172-175	4
β-strand	179-187	9	21
β-strand	201-204	4	21

Chain F: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	32-34	3
β-strand	37	1	22
α-helix	46-48	3
β-strand	52-54	3	23
β-strand	55	1	24
β-strand	64	1	24
β-strand	75	1	22
β-strand	85	1	25
β-strand	89-92	4	23
β-strand	97-98	2	23
β-strand	105	1	25
β-strand	113	1	26
α-helix	114-116	3
β-strand	117-120	4	27
β-strand	128-132	5	27
α-helix	145-147	3
β-strand	155-156	2	28
β-strand	175-177	3	27
β-strand	191-192	2	28
β-strand	202	1	26
α-helix	204	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-10	A, D	protein	160	Homo sapiens	P22301 (AlphaFold model)
Interleukin-10 receptor subunit alpha	B, E	protein	214	Homo sapiens	Q13651 (AlphaFold model)
Interleukin-10 receptor subunit beta	C, F	protein	201	Homo sapiens	Q08334 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>6X93_1 Interleukin-10 (chains A, D)
SPGQGTQSENSCTHFPGYLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYL
GCQALSEMIQFYLEEVMPQAENQDPDIKAHVQSLGENLKDLRLWLRRCHRFLPCENKSKA
VEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Sequence of entity 2 (B, E), FASTA

>6X93_2 Interleukin-10 receptor subunit alpha (chains B, E)
HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSY
DLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFILG
KIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEF
CVQVKPSVASRSNKGMWSKEECISLTRQYFTVTN

Sequence of entity 3 (C, F), FASTA

>6X93_3 Interleukin-10 receptor subunit beta (chains C, F)
MVPPPENVRMNSVNFKNILQWESPAFAKGQLTFTAQYLSYRIFQDKCMQTTLTECDFSSL
SKYGDHTLRVRAEFADEHSDWVQITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENE
YETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRN
KAGEWSEPVCEQTTHDETVPS

Primary citation

Structure-based decoupling of the pro- and anti-inflammatory functions of interleukin-10. Saxton, R.A., Tsutsumi, N., Su, L.L. et al. Science (2021) 371. DOI 10.1126/science.abc8433 · PubMed

Other PDB entries of the same protein (UniProt P22301 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ILK 1.6 Å, Crystal structure of human interleukin-10 at 1.6 Å resolution
1ILK 1.8 Å, Interleukin-10 crystal structure reveals the functional dimer with an unexpected…
1LK3 1.91 Å, Engineered human interleukin-10 monomer complexed to 9D7 FAB fragment
1INR 2.0 Å, Cytokine synthesis
2H24 2.0 Å, Crystal structure of human IL-10
8SVE 2.4 Å, Structure of Monomeric Interleukin-10 Grafted into and Antibody CDR
1Y6K 2.52 Å, Crystal structure of human IL-10 complexed with the soluble IL-10R1 chain
1J7V 2.9 Å, Human il-10 / il-10R1 complex

Browse structure collections

About this viewer

MolViewer shows 6X93 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.