2ILK: Human interleukin-10

Crystal structure of human interleukin-10 at 1.6 Å resolution. Determined by X-ray diffraction at 1.6 Å resolution. Released 14 Oct 1996.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,598
Mol. weight: 18.96 kDa
Released: 14 Oct 1996

Explore 2ILK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ILK contains 11 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	19-31	13
α-helix	34-40	7
α-helix	50-57	8
α-helix	61-71	11
α-helix	72-76	5
α-helix	77-81	5
α-helix	88-107	20
α-helix	113-115	3
α-helix	119-130	12
α-helix	133-141	9
α-helix	143-158	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-10	A	protein	160	Homo sapiens	P22301 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ILK_1 INTERLEUKIN-10 (chains A)
SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYL
GCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKA
VEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Primary citation

Crystal structure of human interleukin-10 at 1.6 A resolution and a model of a complex with its soluble receptor. Zdanov, A., Schalk-Hihi, C., Wlodawer, A. Protein Sci (1996) 5:1955-1962. PubMed

Other PDB entries of the same protein (UniProt P22301 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ILK 1.8 Å, Interleukin-10 crystal structure reveals the functional dimer with an unexpected…
1LK3 1.91 Å, Engineered human interleukin-10 monomer complexed to 9D7 FAB fragment
1INR 2.0 Å, Cytokine synthesis
2H24 2.0 Å, Crystal structure of human IL-10
8SVE 2.4 Å, Structure of Monomeric Interleukin-10 Grafted into and Antibody CDR
1Y6K 2.52 Å, Crystal structure of human IL-10 complexed with the soluble IL-10R1 chain
1J7V 2.9 Å, Human il-10 / il-10R1 complex
6X93 3.5 Å, Interleukin-10 signaling complex with IL-10RA and IL-10RB

Browse structure collections

About this viewer

MolViewer shows 2ILK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.