Direct observation of better hydration at the N-terminus of an alpha-helix with glycine rather than alanine as N-cap. Determined by X-ray diffraction at 1.7 Å resolution. Released 31 Jan 1994.
Explore 1YPC in 3D Show helices and sheets RCSB PDB PDBe
1YPC contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 23 | 1 | 1 |
| α-helix | 25-27 | 3 | |
| β-strand | 31 | 1 | 2 |
| α-helix | 32-42 | 11 | |
| β-strand | 47-52 | 6 | 1 |
| β-strand | 65-70 | 6 | 1 |
| β-strand | 75 | 1 | 2 |
| β-strand | 76 | 1 | 1 |
| β-strand | 81-82 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chymotrypsin inhibitor 2 | I | protein | 64 | Hordeum vulgare | P01053 (AlphaFold model) |
>1YPC_1 CHYMOTRYPSIN INHIBITOR 2 (chains I) MKTEWPELVGKSVAAAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLDNIAQV PRVG
Direct observation of better hydration at the N terminus of an alpha-helix with glycine rather than alanine as the N-cap residue. Harpaz, Y., Elmasry, N., Fersht, A.R. et al. Proc Natl Acad Sci U S A (1994) 91:311-315. DOI 10.1073/pnas.91.1.311 · PubMed
Other PDB entries of the same protein (UniProt P01053 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1YPC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.