1YS5: Lipoprotein

Solution structure of the antigenic domain of GNA1870 of Neisseria meningitidis. Determined by solution NMR. Released 7 Feb 2006.

Method: Solution NMR
Organism: Neisseria meningitidis
Chains: 1
Atoms: 1,164
Mol. weight: 17.63 kDa
Released: 7 Feb 2006

Explore 1YS5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YS5 contains 3 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	18-22	5
α-helix	38-42	5
β-strand	50	1	1
β-strand	55-58	4	2
β-strand	65-67	3	2
β-strand	70	1	3
β-strand	72	1	1
β-strand	79	1	3
β-strand	82	1	2
α-helix	88-90	3
β-strand	92-94	3	2
β-strand	109	1	2
β-strand	112-115	4	2
β-strand	118-125	8	2
β-strand	137-141	5	2
β-strand	148-154	7	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
lipoprotein	A	protein	164	Neisseria meningitidis	Q9JXV4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1YS5_1 lipoprotein (chains A)
MQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGS
DDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEK
GSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQLEHHHHHH

Primary citation

Solution structure of the immunodominant domain of protective antigen GNA1870 of Neisseria meningitidis. Cantini, F., Savino, S., Scarselli, M. et al. J Biol Chem (2006) 281:7220-7227. DOI 10.1074/jbc.M508595200 · PubMed

Other PDB entries of the same protein (UniProt Q9JXV4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UP2 1.6 Å, Murine Fab JAR 4 bound to meningococcal Factor H binding protein
5NQZ 1.63 Å, Structure of a fHbp(V1.1):PorA(P1.16) chimera. Fusion at fHbp position 309.
7LCV 1.7 Å, Factor H enhancing human antibody fragment (Fab) to meningococcal Factor H binding protein
2YPV 1.8 Å, Crystal structure of the Meningococcal vaccine antigen factor H binding protein in…
2Y7S 1.9 Å, Structure of a designed meningococcal antigen (factor H binding protein, mutant G1)…
7KET 2.0 Å, Factor H enhancing human antibody fragment (Fab) to meningococcal Factor H binding protein
5O14 2.19 Å, Co-crystal structure of a cross-reactive bactericidal human antibody targeting…
2W80 2.35 Å, Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs…
2W81 2.35 Å, Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs…
4AYD 2.4 Å, Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria…
6XZW 2.4 Å, Crystal structure of the meningococcal vaccine antigen fHbp in complex with a…
4AYE 2.8 Å, Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria…

Browse structure collections

About this viewer

MolViewer shows 1YS5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.