1YYE: Estrogen receptor beta

Crystal structure of estrogen receptor beta complexed with way-202196. Determined by X-ray diffraction at 2.03 Å resolution. Released 28 Feb 2006.

Method: X-ray diffraction
Resolution: 2.03 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,073
Mol. weight: 63.38 kDa
Ligands: 196
Released: 28 Feb 2006

Explore 1YYE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YYE contains 27 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	265-275	11
α-helix	276-279	4
α-helix	291-314	24
α-helix	319-321	3
α-helix	324-347	24
β-strand	353-357	5	1
β-strand	360-363	4	1
α-helix	364-369	6
α-helix	373-390	18
α-helix	394-406	13
α-helix	423-443	21
α-helix	448-481	34
α-helix	489-499	11

Chain B: 14 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	265-275	11
α-helix	277-281	5
α-helix	283-285	3
α-helix	288-289	2
α-helix	291-314	24
α-helix	319-321	3
α-helix	324-346	23
β-strand	353-357	5	2
β-strand	360-363	4	2
α-helix	365-369	5
α-helix	373-390	18
α-helix	394-407	14
α-helix	422-442	21
α-helix	448-459	12
α-helix	462-481	20
α-helix	490-495	6

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	605-610	6

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	605-611	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Estrogen receptor beta	A, B	protein	268	Homo sapiens	Q92731 (AlphaFold model)
Steroid receptor coactivator-1	C, D	protein	13		Q15788 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1YYE_1 Estrogen receptor beta (chains A, B)
LSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVEL
SLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLA
TTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDADSSRKLAHLLNAVTDALVWVIA
KSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLRG
CKSSITGSECSPAEDSKSKEGSQNPQSQ

Sequence of entity 2 (C, D), FASTA

>1YYE_2 STEROID RECEPTOR COACTIVATOR-1 (chains C, D)
SGSHKLVQLLTTT

Ligands and cofactors

ID	Name	Formula	Copies
196	3-(3-fluoro-4-hydroxyphenyl)-7-hydroxy-1-naphthonitrile	C17 H10 F N O2	2

Primary citation

ERbeta ligands. 3. Exploiting two binding orientations of the 2-phenylnaphthalene scaffold to achieve ERbeta selectivity. Mewshaw, R.E., Edsall Jr., R.J., Yang, C. et al. J Med Chem (2005) 48:3953-3979. DOI 10.1021/jm058173s · PubMed

Other PDB entries of the same protein (UniProt Q92731 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3OLL 1.5 Å, Crystal structure of phosphorylated estrogen receptor beta ligand binding domain
7XVY 1.54 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with S-DPN
1QKM 1.8 Å, Human oestrogen receptor beta ligand-binding domain in complex with partial agonist…
7XWQ 1.89 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with…
7XWP 1.92 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with…
2YJD 1.93 Å, Stapled peptide bound to Estrogen Receptor Beta
3OMQ 1.97 Å, Fragment-Based Design of novel Estrogen Receptor Ligands
9ECF 2.0 Å, Crystal structure of the hERbeta LBD complexed with androstenediol and SRC 2-2 peptide…
3OMP 2.05 Å, Fragment-Based Design of novel Estrogen Receptor Ligands
7XVZ 2.08 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with…
2NV7 2.1 Å, Crystal Structure of Estrogen Receptor Beta Complexed with WAY-555
4J24 2.1 Å, Estrogen Receptor in complex with proline-flanked LXXLL peptides

Browse structure collections

About this viewer

MolViewer shows 1YYE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.