1YZQ: GppNHp-Bound Rab6 GTPase

GppNHp-Bound Rab6 GTPase. Determined by X-ray diffraction at 1.78 Å resolution. Released 26 Jul 2005.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,516
Mol. weight: 19.92 kDa
Ligands: GNP, MG
Released: 26 Jul 2005

Explore 1YZQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YZQ contains 8 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	15-20	6	1
α-helix	26-35	10
β-strand	48-56	9	1
β-strand	61-69	9	1
α-helix	73-78	6
α-helix	79-83	5
β-strand	88-94	7	1
α-helix	98-102	5
α-helix	104-115	12
β-strand	120-126	7	1
α-helix	131-133	3
α-helix	138-147	10
β-strand	151-154	4	1
α-helix	163-173	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
small GTP binding protein RAB6 isoform	A	protein	170	Homo sapiens	P20340 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1YZQ_1 small GTP binding protein RAB6 isoform (chains A)
GSPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLW
DTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNK
TDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGM

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	1
MG	Magnesium ion	Mg	1

Primary citation

Structural basis of family-wide Rab GTPase recognition by rabenosyn-5. Eathiraj, S., Pan, X., Ritacco, C. et al. Nature (2005) 436:415-419. DOI 10.1038/nature03798 · PubMed

Other PDB entries of the same protein (UniProt P20340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2GIL 1.82 Å, Structure of the extremely slow GTPase Rab6A in the GTP bound form at 1.8 resolution
4DKX 1.9 Å, Crystal Structure of the Rab 6A'(Q72L)
5LEF 2.09 Å, Rab6A:Kif20A complex
3BBP 3.0 Å, Rab6-GTP:GCC185 Rab binding domain complex
3CWZ 3.2 Å, Structure of RAB6(GTP)-R6IP1 complex

Browse structure collections

About this viewer

MolViewer shows 1YZQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.