3BBP: Rab6-GTP:GCC185 Rab binding domain complex

Rab6-GTP:GCC185 Rab binding domain complex. Determined by X-ray diffraction at 3.0 Å resolution. Released 5 Feb 2008.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 6
Atoms: 4,856
Mol. weight: 97.66 kDa
Ligands: MG, GTP
Released: 5 Feb 2008

Explore 3BBP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BBP contains 27 α-helices and 24 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	15-20	6	1
α-helix	26-34	9
β-strand	48-57	10	1
β-strand	60-69	10	1
α-helix	74-76	3
α-helix	79-83	5
β-strand	88-94	7	1
α-helix	98-102	5
α-helix	104-115	12
β-strand	120-126	7	1
α-helix	128-130	3
α-helix	138-147	10
β-strand	151-154	4	1
β-strand	156	1	2
β-strand	161	1	2
α-helix	163-171	9

Chain B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	15-20	6	3
α-helix	26-34	9
β-strand	48-53	6	3
β-strand	64-69	6	3
α-helix	74-76	3
α-helix	79-83	5
β-strand	88-94	7	3
α-helix	98-102	5
α-helix	104-115	12
β-strand	120-126	7	3
α-helix	128-130	3
α-helix	138-147	10
β-strand	151-154	4	3
β-strand	156	1	4
β-strand	161	1	4
α-helix	163-171	9

Chain C: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	15-20	6	5
α-helix	26-34	9
β-strand	48-56	9	5
β-strand	61-69	9	5
α-helix	74-76	3
α-helix	79-83	5
β-strand	88-94	7	5
α-helix	98-102	5
α-helix	104-115	12
β-strand	120-126	7	5
α-helix	128-130	3
α-helix	138-147	10
β-strand	151-154	4	5
β-strand	156	1	6
β-strand	161	1	6
α-helix	163-171	9

Chains D and E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1574-1605	32

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1579-1605	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-6A	A, B, C	protein	211	Homo sapiens	P20340 (AlphaFold model)
GRIP and coiled-coil domain-containing protein 2	D, E, F	protein	71	Homo sapiens	Q8IWJ2 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3BBP_1 Ras-related protein Rab-6A (chains A, B, C)
GPGMSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYL
EDRTVRLQLWDTAGLERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGS
DVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGM
ESTQDRSREDMIDIKLEKPQEQPVSEGGCLL

Sequence of entity 2 (D, E, F), FASTA

>3BBP_2 GRIP and coiled-coil domain-containing protein 2 (chains D, E, F)
GPLGSLEPPLWHAEFTKEELVQKLSSTTKSADHLNGLLRETEATNAILMEQIKLLKSEIR
RLERNQEREKS

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	3
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	3

Primary citation

Rab and Arl GTPase family members cooperate in the localization of the golgin GCC185. Burguete, A.S., Fenn, T.D., Brunger, A.T. et al. Cell (2008) 132:286-298. DOI 10.1016/j.cell.2007.11.048 · PubMed

Other PDB entries of the same protein (UniProt P20340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YZQ 1.78 Å, GppNHp-Bound Rab6 GTPase
2GIL 1.82 Å, Structure of the extremely slow GTPase Rab6A in the GTP bound form at 1.8 resolution
4DKX 1.9 Å, Crystal Structure of the Rab 6A'(Q72L)
5LEF 2.09 Å, Rab6A:Kif20A complex
3CWZ 3.2 Å, Structure of RAB6(GTP)-R6IP1 complex

Browse structure collections

About this viewer

MolViewer shows 3BBP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.