2GIL: Ras-related protein Rab-6A

Structure of the extremely slow GTPase Rab6A in the GTP bound form at 1.8 resolution. Determined by X-ray diffraction at 1.82 Å resolution. Released 27 Jun 2006.

Method: X-ray diffraction
Resolution: 1.82 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,065
Mol. weight: 76.67 kDa
Ligands: GTP, MG
Released: 27 Jun 2006

Explore 2GIL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GIL contains 32 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	15-19	5	1
α-helix	26-35	10
β-strand	49-56	8	1
β-strand	61-68	8	1
α-helix	73-75	3
α-helix	79-84	6
β-strand	88-94	7	1
α-helix	98-102	5
α-helix	104-115	12
β-strand	120-126	7	1
α-helix	131-133	3
α-helix	138-147	10
β-strand	151-154	4	1
β-strand	156	1	2
β-strand	161	1	2
α-helix	163-171	9

Chain B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	14-19	6	1
α-helix	26-35	10
β-strand	48-56	9	1
β-strand	61-69	9	1
α-helix	73-78	6
α-helix	80-85	6
β-strand	88-94	7	1
α-helix	98-102	5
α-helix	104-115	12
β-strand	120-126	7	1
α-helix	131-133	3
α-helix	138-148	11
β-strand	151-154	4	1
β-strand	156	1	3
β-strand	161	1	3
α-helix	163-173	11

Chain C: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	15-19	5	4
α-helix	26-35	10
β-strand	48-57	10	4
β-strand	60-69	10	4
α-helix	73-78	6
α-helix	79-85	7
β-strand	88-94	7	4
α-helix	98-102	5
α-helix	104-115	12
β-strand	120-126	7	4
α-helix	131-133	3
α-helix	138-148	11
β-strand	151-155	5	4
β-strand	156	1	5
β-strand	161	1	5
α-helix	163-171	9

Chain D: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	15-20	6	4
α-helix	26-35	10
β-strand	48-56	9	4
β-strand	61-69	9	4
α-helix	73-78	6
α-helix	80-84	5
β-strand	88-94	7	4
α-helix	98-102	5
α-helix	104-115	12
β-strand	120-126	7	4
α-helix	131-133	3
α-helix	138-148	11
β-strand	151-154	4	4
β-strand	156	1	6
β-strand	161	1	6
α-helix	163-173	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-6A	A, B, C, D	protein	162	Homo sapiens	P20340 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2GIL_1 Ras-related protein Rab-6A (chains A, B, C, D)
KFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQ
ERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLAD
KRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAAL

Ligands and cofactors

ID	Name	Formula	Copies
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	4
MG	Magnesium ion	Mg	4

Primary citation

Structure of the extremely slow GTPase Rab6A in the GTP bound form at 1.8 resolution. Bergbrede, T., Pylypenko, O., Rak, A. et al. J Struct Biol (2005) 152:235-238. DOI 10.1016/j.jsb.2005.10.001 · PubMed

Other PDB entries of the same protein (UniProt P20340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YZQ 1.78 Å, GppNHp-Bound Rab6 GTPase
4DKX 1.9 Å, Crystal Structure of the Rab 6A'(Q72L)
5LEF 2.09 Å, Rab6A:Kif20A complex
3BBP 3.0 Å, Rab6-GTP:GCC185 Rab binding domain complex
3CWZ 3.2 Å, Structure of RAB6(GTP)-R6IP1 complex

Browse structure collections

About this viewer

MolViewer shows 2GIL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.