4DKX: Rab 6A'(Q72L)

Crystal Structure of the Rab 6A'(Q72L). Determined by X-ray diffraction at 1.9 Å resolution. Released 17 Oct 2012.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,789
Mol. weight: 50.2 kDa
Ligands: GDP, MG
Released: 17 Oct 2012

Explore 4DKX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DKX contains 16 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	14-19	6	1
α-helix	26-35	10
β-strand	51-56	6	1
β-strand	61-67	7	1
α-helix	76-78	3
α-helix	79-83	5
β-strand	88-94	7	1
α-helix	98-102	5
α-helix	104-115	12
β-strand	120-126	7	1
α-helix	131-133	3
α-helix	138-148	11
β-strand	151-155	5	1
β-strand	156	1	2
β-strand	161	1	2
α-helix	163-173	11

Chain B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	13-20	8	3
α-helix	26-35	10
β-strand	49-57	9	3
β-strand	60-68	9	3
α-helix	72-74	3
α-helix	76-78	3
α-helix	79-83	5
β-strand	88-94	7	3
α-helix	98-115	18
β-strand	120-126	7	3
α-helix	128-133	6
α-helix	138-148	11
β-strand	151-155	5	3
β-strand	156	1	4
β-strand	161	1	4
α-helix	163-172	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-6A	A, B	protein	216	Homo sapiens	P20340 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4DKX_1 Ras-related protein Rab-6A (chains A, B)
MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDR
TIRLQLWDTAGLERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVI
IMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMEST
QDRSREDMIDIKLEKPQEQPVSEGGCSCLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	2
MG	Magnesium ion	Mg	2

Primary citation

Crystal structure of Rab6A'(Q72L) mutant reveals unexpected GDP/Mg2+ binding with opened GTP-binding domain. Shin, Y.-C., Yoon, J.H., Jang, T.-H. et al. Biochem Biophys Res Commun (2012) 424:269-273. DOI 10.1016/j.bbrc.2012.06.102 · PubMed

Other PDB entries of the same protein (UniProt P20340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YZQ 1.78 Å, GppNHp-Bound Rab6 GTPase
2GIL 1.82 Å, Structure of the extremely slow GTPase Rab6A in the GTP bound form at 1.8 resolution
5LEF 2.09 Å, Rab6A:Kif20A complex
3BBP 3.0 Å, Rab6-GTP:GCC185 Rab binding domain complex
3CWZ 3.2 Å, Structure of RAB6(GTP)-R6IP1 complex

Browse structure collections

About this viewer

MolViewer shows 4DKX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.