1Z6U: Np95-like ring finger protein isoform b

Np95-like ring finger protein isoform b [Homo sapiens]. Determined by X-ray diffraction at 2.1 Å resolution. Released 3 May 2005.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,100
Mol. weight: 34.46 kDa
Ligands: ZN
Released: 3 May 2005

Explore 1Z6U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Z6U contains 16 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	694-702	9
α-helix	704-706	3
α-helix	707-713	7
α-helix	714-722	9
α-helix	723-730	8
β-strand	732	1	1
β-strand	739	1	1
β-strand	743-745	3	2
β-strand	751-753	3	2
α-helix	754-762	9
β-strand	767	1	3
β-strand	774	1	3
β-strand	783	1	2
α-helix	785-794	10

Chain B: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	689-693	5
α-helix	694-702	9
α-helix	704-706	3
α-helix	707-714	8
α-helix	717-722	6
α-helix	723-730	8
β-strand	732	1	4
β-strand	739	1	4
β-strand	743-745	3	5
β-strand	751-753	3	5
α-helix	754-762	9
β-strand	767	1	6
β-strand	774	1	6
α-helix	779-781	3
α-helix	785-794	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Np95-like ring finger protein isoform b	A, B	protein	150	Homo sapiens	Q96PU4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1Z6U_1 Np95-like ring finger protein isoform b (chains A, B)
MGSSHHHHHHSSGLVPRGSPSASKVYKASDSAEAIEAFQLTPQQQHLIREDCQNQKLWDE
VLSHLVEGPNFLKKLEQSFMCVCCQELVYQPVTTECFHNVCKDCLQRSFKAQVFSCPACR
HDLGQNYIMIPNEILQTLLDLFFPGYSKGR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

2.1 Angstrom Crystal Structure of the Human Ubiquitin Liagse NIRF. Walker, J.R., Avvakumov, G.V., Xue, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q96PU4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PW7 2.0 Å, structure of UHRF2-SRA in complex with a 5mC-containing DNA
5YCO 2.2 Å, Complex structure of PCNA with UHRF2
4PW5 2.2 Å, structure of UHRF2-SRA in complex with a 5hmC-containing DNA, complex I
4TVR 2.29 Å, Tandem Tudor and PHD domains of UHRF2
3OLN 2.3 Å, Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF2
4PW6 3.79 Å, structure of UHRF2-SRA in complex with a 5hmC-containing DNA, complex II
1WY8 Solution Structure of the N-terminal Ubiquitin-like Domain in Human Np95/ICBP90-like…
2E6S Solution structure of the PHD domain in RING finger protein 107

Browse structure collections

About this viewer

MolViewer shows 1Z6U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.