1ZW3: Vinculin Head

Vinculin Head (0-258) in Complex with the Talin Rod residues 1630-1652. Determined by X-ray diffraction at 3.3 Å resolution. Released 20 Sept 2005.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Gallus gallus
Chains: 2
Atoms: 2,136
Mol. weight: 34.03 kDa
Released: 20 Sept 2005

Explore 1ZW3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZW3 contains 9 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
α-helix	6-27	22
α-helix	40-62	23
α-helix	67-96	30
α-helix	101-146	46
α-helix	153-178	26
β-strand	181	1	1
α-helix	184-198	15
α-helix	201-216	16
α-helix	222-247	26

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1631-1649	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vinculin	A	protein	279	Gallus gallus	P12003 (AlphaFold model)
Talin 1	B	protein	25		P26039 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ZW3_1 Vinculin (chains A)
MGSSHHHHHHSSGLVPRGSHMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDL
TAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPY
SVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTY
TKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKS
QGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWA

Sequence of entity 2 (B), FASTA

>1ZW3_2 Talin 1 (chains B)
PRWSVLAGHSRTVSDSIKKLITSMR

Primary citation

Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod. Gingras, A.R., Ziegler, W.H., Frank, R. et al. J Biol Chem (2005) 280:37217-37224. DOI 10.1074/jbc.M508060200 · PubMed

Other PDB entries of the same protein (UniProt P12003 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QKR 1.8 Å, Crystal structure of the vinculin tail and a pathway for activation
1ZVZ 1.8 Å, Vinculin Head (0-258) in Complex with the Talin Rod Residue 820-844
1T01 2.06 Å, Vinculin complexed with the VBS1 helix from talin
1ZW2 2.1 Å, Vinculin Head (0-258) in Complex with the Talin Rod residues 2345-2369
3ZDL 2.3 Å, Vinculin head (1-258) in complex with a RIAM fragment
4E17 2.3 Å, Alpha-E-catenin is an autoinhibited molecule that co-activates vinculin
1U6H 2.38 Å, Vinculin head (0-258) in complex with the talin vinculin binding site 2 (849-879)
4E18 2.4 Å, Alpha-E-catenin is an autoinhibited molecule that co-activates vinculin
1XWJ 2.6 Å, Vinculin head (1-258) in complex with the talin vinculin binding site 3 (1945-1969)
2GDC 2.74 Å, Structure of Vinculin VD1 / IpaA560-633 complex
6FQ4 2.89 Å, Structure of Chlamydial virulence factor TarP and vinculin head domain
6NR7 3.0 Å, Rerefinement of chicken vinculin

Browse structure collections

About this viewer

MolViewer shows 1ZW3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.