2ABX: Alpha-bungarotoxin

The crystal structure of alpha-bungarotoxin at 2.5 Å resolution. Relation to solution structure and binding to acetylcholine receptor. Determined by X-ray diffraction at 2.5 Å resolution. Released 7 May 1986.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Bungarus multicinctus
Chains: 2
Atoms: 1,118
Mol. weight: 16.01 kDa
Released: 7 May 1986

Explore 2ABX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ABX contains 0 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	25-26	2	1
β-strand	41-42	2	1

Chain B: 0 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	2
β-strand	13-14	2	2
β-strand	24-26	3	3
β-strand	41-42	2	3
β-strand	57-59	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-bungarotoxin	A, B	protein	74	Bungarus multicinctus	P60615 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2ABX_1 ALPHA-BUNGAROTOXIN (chains A, B)
IVCHTTATIPSSAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCC
STDKCNHPPKRQPG

Primary citation

The crystal structure of alpha-bungarotoxin at 2.5 A resolution: relation to solution structure and binding to acetylcholine receptor. Love, R.A., Stroud, R.M. Protein Eng (1986) 1:37-46. DOI 10.1093/protein/1.1.37 · PubMed

Other PDB entries of the same protein (UniProt P60615 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9FYS 1.32 Å, D11 mAbs bound to alpha-Bungarotoxin
9HUB 1.33 Å, D11 mAbs bound to alpha-Bungarotoxin at pH 7.5
1HC9 1.8 Å, alpha-bungarotoxin complexed with high affinity peptide
8VY8 2.4 Å, Recombinant alpha bungarotoxin complexed with HAP peptide
9GU1 2.48 Å, Human adult muscle nAChR in resting state in nanodisc with alpha-bungarotoxin
8DA1 2.67 Å, Crystal structure of Krait alpha-neurotoxin in complex with Centi-LNX-D09 antibody
6UWZ 2.69 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with alpha-bungarotoxin
9GU0 2.96 Å, Human adult muscle nAChR in resting state in detergent with alpha-bungarotoxin
1ABT NMR solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
1BXP Solution NMR structure of the complex of alpha-bungarotoxin with a library derived…
1HAA A beta-Hairpin Structure in a 13-mer Peptide that Binds a-Bungarotoxin with High…
1HAJ A beta-Hairpin Structure in a 13-mer Peptide that Binds a-Bungarotoxin with High…

Browse structure collections

About this viewer

MolViewer shows 2ABX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.