2AEW: Growth hormone receptor

A model for growth hormone receptor activation based on subunit rotation within a receptor dimer. Determined by X-ray diffraction at 2.7 Å resolution. Released 1 Nov 2005.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,026
Mol. weight: 47.9 kDa
Released: 1 Nov 2005

Explore 2AEW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AEW contains 5 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	35-39	5	1
β-strand	40	1	2
β-strand	46-50	5	1
β-strand	64-69	6	3
β-strand	81-82	2	3
β-strand	93-96	4	1
α-helix	98-101	4
β-strand	107-113	7	3
β-strand	116-123	8	3
β-strand	129	1	2
α-helix	131-134	4
β-strand	135-144	10	4
β-strand	150-158	9	4
β-strand	172-180	9	5
β-strand	187-188	2	5
β-strand	192	1	5
β-strand	196-203	8	4
β-strand	207-216	10	5
β-strand	222-225	4	5
β-strand	229-232	4	5

Chain B: 3 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	35-39	5	6
β-strand	40	1	7
β-strand	46-50	5	6
β-strand	64-69	6	8
β-strand	81-82	2	8
β-strand	93-96	4	6
α-helix	98-100	3
β-strand	107-113	7	8
β-strand	116-123	8	8
β-strand	129	1	7
α-helix	131-134	4
β-strand	135-144	10	9
β-strand	150-158	9	9
β-strand	172-180	9	10
β-strand	187-188	2	10
α-helix	189-191	3
β-strand	192	1	10
β-strand	196-203	8	9
β-strand	207-216	10	10
β-strand	225	1	10
β-strand	229-232	4	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Growth hormone receptor	A, B	protein	205	Homo sapiens	P10912 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2AEW_1 Growth hormone receptor (chains A, B)
SSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVS
AGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTG
IHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEY
EVRVRSKQRNSGNYGEFSEVLYVTL

Primary citation

Model for growth hormone receptor activation based on subunit rotation within a receptor dimer. Brown, R.J., Adams, J.J., Pelekanos, R.A. et al. Nat Struct Mol Biol (2005) 12:814-821. DOI 10.1038/nsmb977 · PubMed

Other PDB entries of the same protein (UniProt P10912 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1AXI 2.1 Å, Structural plasticity at the hgh:hghbp interface
1HWG 2.5 Å, 1:2 complex of human growth hormone with its soluble binding protein
1A22 2.6 Å, Human growth hormone bound to single receptor
1KF9 2.6 Å, Phage display derived variant of human growth hormone complexed with two copies of the…
3HHR 2.8 Å, Human growth hormone and extracellular domain of its receptor: crystal structure of the…
1HWH 2.9 Å, 1:1 complex of human growth hormone mutant G120R with its soluble binding protein
5OEK Putative active dimeric state of GHR transmembrane domain
5OHD Putative inactive (dormant) dimeric state of GHR transmembrane domain

Browse structure collections

About this viewer

MolViewer shows 2AEW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.