2AGH: Myb proto-oncogene protein

Name: PDB 2AGH: Structural basis for cooperative transcription factor binding to the CBP coactivator
Published: 2005-11-22
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Structural basis for cooperative transcription factor binding to the CBP coactivator. Determined by solution NMR. Released 22 Nov 2005.

Method: Solution NMR
Organisms: Mus musculus, Homo sapiens
Chains: 3
Atoms: 1,161
Mol. weight: 16.61 kDa
Released: 22 Nov 2005

Explore 2AGH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AGH contains 8 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	293-303	11
α-helix	305-310	6

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	592-594	3
α-helix	597-611	15
α-helix	617-620	4
α-helix	625-641	17
α-helix	646-667	22

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	847-856	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myb proto-oncogene protein	A	protein	25	Mus musculus	P06876 (AlphaFold model)
Crebbp protein	B	protein	87	Mus musculus	P45481 (AlphaFold model)
Zinc finger protein HRX	C	protein	31	Homo sapiens	Q03164

Sequence of entity 1 (A), FASTA

>2AGH_1 Myb proto-oncogene protein (chains A)
KEKRIKELELLLMSTENELKGQQAL

Sequence of entity 2 (B), FASTA

>2AGH_2 Crebbp protein (chains B)
GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANS
RDEYYHLLAEKIYKIQKELEEKRRSRL

Sequence of entity 3 (C), FASTA

>2AGH_3 Zinc finger protein HRX (chains C)
SDDGNILPSDIMDFVLKNTPSMQALGESPES

Primary citation

Structural Basis for Cooperative Transcription Factor Binding to the CBP Coactivator. De Guzman, R.N., Goto, N.K., Dyson, H.J. et al. J Mol Biol (2006) 355:1005-1013. DOI 10.1016/j.jmb.2005.09.059 · PubMed

Other PDB entries of the same protein (UniProt P06876 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GVD 1.45 Å, Crystal structure of C-myb R2 V103L mutant
1GV5 1.58 Å, Crystal structure of C-myb R2
1GUU 1.6 Å, Crystal structure of C-myb R1
1GV2 1.68 Å, Crystal structure of C-myb R2R3
6DNQ 2.35 Å, HBZ77 in complex with KIX and c-Myb
1H89 2.45 Å, Crystal structure of ternary protein-DNA COMPLEX2
1H88 2.8 Å, Crystal structure of ternary protein-DNA COMPLEX1
6DMX 2.8 Å, HBZ56 in complex with KIX and c-Myb
1IDY Structure of myb transforming protein, NMR, minimized average structure
1IDZ Structure of myb transforming protein, NMR, 20 structures
1MBE Mouse C-myb DNA-binding domain repeat 1
1MBF Mouse C-myb DNA-binding domain repeat 1

Browse structure collections

About this viewer

MolViewer shows 2AGH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.