Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing trimethyllysine 4 and phosphothreonine 3. Determined by X-ray diffraction at 2.45 Å resolution. Released 27 Dec 2005.
Explore 2B2T in 3D Show helices and sheets RCSB PDB PDBe
2B2T contains 21 α-helices and 23 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 15 | 1 | 1 |
| β-strand | 16-24 | 9 | 2 |
| α-helix | 32-34 | 3 | |
| α-helix | 36-42 | 7 | |
| β-strand | 58-64 | 7 | 2 |
| α-helix | 69-71 | 3 | |
| β-strand | 73-75 | 3 | 2 |
| α-helix | 77-82 | 6 | |
| β-strand | 86 | 1 | 1 |
| α-helix | 89-103 | 15 | |
| α-helix | 110-129 | 20 | |
| β-strand | 133-139 | 7 | 3 |
| β-strand | 140 | 1 | 4 |
| α-helix | 148-150 | 3 | |
| β-strand | 151-155 | 5 | 3 |
| α-helix | 160-162 | 3 | |
| β-strand | 164-166 | 3 | 3 |
| α-helix | 168-184 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 15 | 1 | 5 |
| β-strand | 16-25 | 10 | 6 |
| α-helix | 36-42 | 7 | |
| β-strand | 57-64 | 8 | 6 |
| α-helix | 69-71 | 3 | |
| β-strand | 73-75 | 3 | 6 |
| α-helix | 77-82 | 6 | |
| β-strand | 86 | 1 | 5 |
| α-helix | 89-104 | 16 | |
| α-helix | 110-129 | 20 | |
| β-strand | 133-139 | 7 | 7 |
| β-strand | 151-155 | 5 | 7 |
| α-helix | 160-162 | 3 | |
| β-strand | 164-166 | 3 | 7 |
| α-helix | 168-184 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 15 | 1 | 8 |
| β-strand | 16-25 | 10 | 9 |
| α-helix | 32-34 | 3 | |
| α-helix | 36-42 | 7 | |
| β-strand | 44 | 1 | 4 |
| β-strand | 57-64 | 8 | 9 |
| α-helix | 69-71 | 3 | |
| β-strand | 73-75 | 3 | 9 |
| α-helix | 77-83 | 7 | |
| β-strand | 86 | 1 | 8 |
| α-helix | 89-94 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chromodomain-helicase-DNA-binding protein 1 | A, B | protein | 187 | Homo sapiens | O14646 (AlphaFold model) |
| Chromodomain-helicase-DNA-binding protein 1 | C | protein | 115 | Homo sapiens | O14646 (AlphaFold model) |
| Histone H3 tail | D | protein | 20 | P68431 (AlphaFold model) |
>2B2T_1 Chromodomain-helicase-DNA-binding protein 1 (chains A, B) MKKHHHHHHEEEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQY LIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQ ELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQAMID EYFSRKK
>2B2T_2 Chromodomain-helicase-DNA-binding protein 1 (chains C) MKKHHHHHHEEEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQY LIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEY
>2B2T_3 Histone H3 tail (chains D) ARTKQTARKSTGGKAPRKQY
Double chromodomains cooperate to recognize the methylated histone H3 tail. Flanagan, J.F., Mi, L.Z., Chruszcz, M. et al. Nature (2005) 438:1181-1185. DOI 10.1038/nature04290 · PubMed
Other PDB entries of the same protein (UniProt O14646 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2B2T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.