4NW2: Tandem chromodomains of human CHD1

Tandem chromodomains of human CHD1 in complex with Influenza virus NS1 C-terminal tail trimethylated at K229. Determined by X-ray diffraction at 1.9 Å resolution. Released 29 Jan 2014.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Homo sapiens, Influenza A virus
Chains: 4
Atoms: 3,149
Mol. weight: 49.74 kDa
Released: 29 Jan 2014

Explore 4NW2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NW2 contains 18 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	273	1	1
β-strand	274-284	11	2
α-helix	290-292	3
α-helix	294-300	7
β-strand	314-322	9	2
α-helix	327-329	3
β-strand	331-333	3	2
α-helix	335-340	6
β-strand	344	1	1
α-helix	347-363	17
α-helix	368-387	20
β-strand	391-401	11	3
α-helix	406	1
β-strand	407-413	7	3
α-helix	418-420	3
β-strand	422-424	3	3
α-helix	426-440	15

Chain C: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	273	1	4
β-strand	274-284	11	5
α-helix	289-292	4
α-helix	294-300	7
β-strand	314-322	9	5
α-helix	327-329	3
β-strand	331-333	3	5
α-helix	335-340	6
β-strand	344	1	4
α-helix	347-364	18
α-helix	368-387	20
β-strand	391-397	7	6
β-strand	409-413	5	6
α-helix	418-420	3
β-strand	422-424	3	6
α-helix	426-432	7
α-helix	434-441	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromodomain-helicase-DNA-binding protein 1	A, C	protein	194	Homo sapiens	O14646 (AlphaFold model)
Nonstructural protein 1	B, D	protein	15	Influenza A virus	P03495

Sequence of entity 1 (A, C), FASTA

>4NW2_1 Chromodomain-helicase-DNA-binding protein 1 (chains A, C)
MHHHHHHSSGRENLYFQGEEEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEK
NKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPE
DVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALI
SKKFQACIDEYFSR

Sequence of entity 2 (B, D), FASTA

>4NW2_2 Nonstructural protein 1 (chains B, D)
PKQKRKMARTARSKV

Primary citation

Structural basis for histone mimicry and hijacking of host proteins by influenza virus protein NS1. Qin, S., Liu, Y., Tempel, W. et al. Nat Commun (2014) 5:3952-3952. DOI 10.1038/ncomms4952 · PubMed

Other PDB entries of the same protein (UniProt O14646 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9T9F 1.35 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
9T9H 1.45 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
9T9I 1.55 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
5AFW 1.6 Å, Assembly of methylated LSD1 and CHD1 drives AR-dependent transcription and translocation
4B4C 1.62 Å, Crystal structure of the DNA-binding domain of human CHD1.
9T9E 1.7 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
9T9G 1.7 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
4O42 1.87 Å, Tandem chromodomains of human CHD1 in complex with influenza NS1 C-terminal tail…
2B2Y 2.35 Å, Tandem chromodomains of human CHD1
2B2W 2.4 Å, Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing…
2B2T 2.45 Å, Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing…
2B2V 2.65 Å, Crystal structure analysis of human CHD1 chromodomains 1 and 2 bound to histone H3 resi…

Browse structure collections

About this viewer

MolViewer shows 4NW2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.