2B2Y: Tandem chromodomains of human CHD1

Tandem chromodomains of human CHD1. Determined by X-ray diffraction at 2.35 Å resolution. Released 27 Dec 2005.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,707
Mol. weight: 57.99 kDa
Released: 27 Dec 2005

Explore 2B2Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2B2Y contains 20 α-helices and 24 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
β-strand	16-25	10	2
α-helix	36-42	7
β-strand	57-64	8	2
α-helix	69-71	3
β-strand	73-75	3	2
α-helix	77-82	6
β-strand	86	1	1
α-helix	88-104	17
α-helix	110-129	20
β-strand	133-139	7	3
β-strand	140	1	4
β-strand	141-143	3	3
β-strand	149-155	7	3
α-helix	160-162	3
β-strand	164-166	3	3
α-helix	168-184	17

Chain B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	5
β-strand	16-24	9	6
α-helix	32-34	3
α-helix	36-42	7
β-strand	58-64	7	6
α-helix	69-71	3
β-strand	73-75	3	6
α-helix	77-83	7
β-strand	86	1	5
α-helix	89-105	17
α-helix	110-129	20
β-strand	133-139	7	7
β-strand	151-155	5	7
α-helix	160-162	3
β-strand	164-166	3	7
α-helix	168-183	16

Chain C: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	8
β-strand	16-25	10	9
α-helix	32-34	3
α-helix	36-42	7
β-strand	44	1	4
β-strand	57-64	8	9
α-helix	69-71	3
β-strand	73-75	3	9
α-helix	77-83	7
β-strand	86	1	8
α-helix	89-95	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromodomain-helicase-DNA-binding protein 1	A, B	protein	187	Homo sapiens	O14646 (AlphaFold model)
Chromodomain-helicase-DNA-binding protein 1	C	protein	115	Homo sapiens	O14646 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2B2Y_1 Chromodomain-helicase-DNA-binding protein 1 (chains A, B)
MKKHHHHHHEEEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQY
LIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQ
ELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACID
EYFSRKK

Sequence of entity 2 (C), FASTA

>2B2Y_2 Chromodomain-helicase-DNA-binding protein 1 (chains C)
MKKHHHHHHEEEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQY
LIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEY

Primary citation

Double chromodomains cooperate to recognize the methylated histone H3 tail. Flanagan, J.F., Mi, L.Z., Chruszcz, M. et al. Nature (2005) 438:1181-1185. DOI 10.1038/nature04290 · PubMed

Other PDB entries of the same protein (UniProt O14646 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9T9F 1.35 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
9T9H 1.45 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
9T9I 1.55 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
5AFW 1.6 Å, Assembly of methylated LSD1 and CHD1 drives AR-dependent transcription and translocation
4B4C 1.62 Å, Crystal structure of the DNA-binding domain of human CHD1.
9T9E 1.7 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
9T9G 1.7 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
4O42 1.87 Å, Tandem chromodomains of human CHD1 in complex with influenza NS1 C-terminal tail…
4NW2 1.9 Å, Tandem chromodomains of human CHD1 in complex with Influenza virus NS1 C-terminal tail…
2B2W 2.4 Å, Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing…
2B2T 2.45 Å, Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing…
2B2V 2.65 Å, Crystal structure analysis of human CHD1 chromodomains 1 and 2 bound to histone H3 resi…

Browse structure collections

About this viewer

MolViewer shows 2B2Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.